Scaffold : Scaffold_1
Gene_id : Albla_Nc14000280
Description : conserved hypothetical protein
ATGCCATCTCGAGTGGTAAATGGACAGGCGGCGAATGCCACTGAAGCTGATTTTGCTCGGATGACTTTTCCTTGTTATCTAGAGTTTTTTTGTCGAATTG
CGATACTTTATTTTTCTGCAACGGCACAAATTAACGAAGATGAGCATCATGAAACGAGATCACGAAGCCCATTAGACTTGGAAAATTGTCTTGCGCCATT
CATTGCCAATTTCACCCAGACTTCGCACGGAAGTTTTGATACGCCAACACCGATGCGTCGACTATTGCACTCCCAATCGATAACAAAAAGTCAGATGAAT
CTGTGCATTGTGAGGCTGATAGAGATAATGGATGCTACAAATACTTCCTCAGAGGAAATTTTGGAGCGCTATGTCTTTGGGCGGCGAGGAAACGGTCAAT
CATATAAATCAGAAAGCTCAAAAAGCATTGGAAGTTACACTTGTGGCCGACATATGCAACGCGTTCCTGTGAATGTGAGACTCCTTCGAGAAATTCTACT
CCTTCCAGAGTCACTCAACAACTTGAGAGCGTACACTGAAATATTACAGGCTCAGCACACGAAAGACTTCGAGGTAATTCACAATATTCTATGGATTTTT
CTCATATCGAGTATTTTCTGCCCAGCTTGCAGTGACACGACTAGAAAGTTTCCAGGCCGAGTCATTAGCGTAAGCATCAATGTGAAATGAATGTGCCTAG
AAGCTCAGACCTTATTCGCCTTATTAGAAATGACACTCTGGATTCAGAACTCGGTCTTTTCTTTATTTTGATGGAAGCTCGATTTGCGATAGCGCTTGCA
ATGACACACAGGCACTACGACTGTACATTGATGCTCTGGATATGATACAAGACCTTTCTCTAGTACATCCAGGACGAGCGATGGCTGAAAGTTGCGTCGG
CACAACGTTGTACTACGCAGGAGAGTTTGAGCTCGCTCGGAAATATCACCAGGAAGCTCTTGCTACTCGTATACGCGCGATTATGTCCTTGCGTGGAAAA
AGTGCTGAAATAATGATGAAAAGCATCGAGGGCGACGATTTCAATACTGCAATAGCAATGAACAACCTTGCTTGCTGTCTCTACTCGACAGGAGAAACGG
AATGCGATGGGCAAGCTTGCCTTCTCATAGACTGGGCCTTCAGGATTTACAAGAAATTATATGGCCTTGAGAGCCCAAGAACCTCCCAAGTTGCTCACAA
GGCGGAGATGATTCGCTCAAGGCAACTCAAAATGAGGAAGAAACTACCGGAAGCCAATGCTAACATGGAGTATCTCAGCGTCATATCAAATGCTTTTCTT
CAGATAGTGGTGCCAAAAGATCCTGCACAGCCTAGAAAGGAAGATCGAGGCATTGAGCGAAACACTATGAGACAGAAAAAAGGCGAATCCAAACGAAAGC
AAAAATG
	
	
ATGCCATCTCGAGTGGTAAATGGACAGGCGGCGAATGCCACTGAAGCTGATTTTGCTCGGATGACTTTTCCTTGTTATCTAGAGTTTTTTTGTCGAATTG
CGATACTTTATTTTTCTGCAACGGCACAAATTAACGAAGATGAGCATCATGAAACGAGATCACGAAGCCCATTAGACTTGGAAAATTGTCTTGCGCCATT
CATTGCCAATTTCACCCAGACTTCGCACGGAAGTTTTGATACGCCAACACCGATGCGTCGACTATTGCACTCCCAATCGATAACAAAAAGTCAGATGAAT
CTGTGCATTGTGAGGCTGATAGAGATAATGGATGCTACAAATACTTCCTCAGAGGAAATTTTGGAGCGCTATGTCTTTGGGCGGCGAGGAAACGGTCAAT
CATATAAATCAGAAAGCTCAAAAAGCATTGGAAGTTACACTTGTGGCCGACATATGCAACGCGTTCCTGTGAATGTGAGACTCCTTCGAGAAATTCTACT
CCTTCCAGAGTCACTCAACAACTTGAGAGCGTACACTGAAATATTACAGGCTCAGCACACGAAAGACTTCGAGCTTGCAGTGACACGACTAGAAAGTTTC
CAGGCCGAGTCATTAGCAACTCGGTCTTTTCTTTATTTTGATGGAAGCTCGATTTGCGATAGCGCTTGCAATGACACACAGGCACTACGACTGTACATTG
ATGCTCTGGATATGATACAAGACCTTTCTCTAGTACATCCAGGACGAGCGATGGCTGAAAGTTGCGTCGGCACAACGTTGTACTACGCAGGAGAGTTTGA
GCTCGCTCGGAAATATCACCAGGAAGCTCTTGCTACTCGTATACGCGCGATTATGTCCTTGCGTGGAAAAAGTGCTGAAATAATGATGAAAAGCATCGAG
GGCGACGATTTCAATACTGCAATAGCAATGAACAACCTTGCTTGCTGTCTCTACTCGACAGGAGAAACGGAATGCGATGGGCAAGCTTGCCTTCTCATAG
ACTGGGCCTTCAGGATTTACAAGAAATTATATGGCCTTGAGAGCCCAAGAACCTCCCAAGTTGCTCACAAGGCGGAGATGATTCGCTCAAGGCAACTCAA
AATGAGGAAGAAACTACCGGAAGCCAATGCTAACATGGAGTATCTCAGCGTCATATCAAATGCTTTTCTTCAGATAGTGGTGCCAAAAGATCCTGCACAG
CCTAGAAAGGAAGATCGAGGCATTGAGCGAAACACTATGAGACAGAAAAAAGGCGAATCCAAACGAAAGCAAAAATGA
	
	
MPSRVVNGQAANATEADFARMTFPCYLEFFCRIAILYFSATAQINEDEHHETRSRSPLDLENCLAPFIANFTQTSHGSFDTPTPMRRLLHSQSITKSQMN
LCIVRLIEIMDATNTSSEEILERYVFGRRGNGQSYKSESSKSIGSYTCGRHMQRVPVNVRLLREILLLPESLNNLRAYTEILQAQHTKDFELAVTRLESF
QAESLATRSFLYFDGSSICDSACNDTQALRLYIDALDMIQDLSLVHPGRAMAESCVGTTLYYAGEFELARKYHQEALATRIRAIMSLRGKSAEIMMKSIE
GDDFNTAIAMNNLACCLYSTGETECDGQACLLIDWAFRIYKKLYGLESPRTSQVAHKAEMIRSRQLKMRKKLPEANANMEYLSVISNAFLQIVVPKDPAQ
PRKEDRGIERNTMRQKKGESKRKQK_