Scaffold : Scaffold_1361
Gene_id : Phypl_g13215
Description : hypothetical protein
ATGAGAGGCGAGCGGATACGGCAagcgcaaggagaagaaaAGTGGATCGCCGATCTAAAAACGTACTTGAAAGGCGACGTTCAGGAGTTATCCGCCGAAG
ACGCCAGGTCCTGTTCCAAGATCGCAGCTGACTACGAGCTGGATGAGAACAATCTGTTGTTCCTTTGTCCCGCAGTGACGCCGAGGAACGAAGATCGTGA
CGCGGTCACCCGACTAGTAGTACCGGAGaccctgcagcaggacgtcTTGCATCATTACCATGCAAGTCTGGAGGGGGGCCACCAGGGGATCGGGCGGACG
TACCTTCGCATCAGATCGCACTTCCACTGGCGAGGCCTATACCGAAGTGTCCAGTGCTGCGTGGGAGAATGTAACGATTGTGAGACCGGGAATTGATGCC
CTCTGGTACAGGGCAAGTCCCCAGGGAACGTGCGAGCAACGTACCCGTTCCAAATCATTGCGATGGACCACATCCCATCGTTGCCGAAGTCTTTCAAGGG
GAACACAGAGTTGCTGGTTTGGGTCGACCTGTTCTCGGGCTACGTGATCGCCAAAGCAAGCGCCTCGCGCACGGCTCAGACCATCGCAGAGAACTACGAG
GAATGCGTGTTCCGACGTTTTGGGGCCAGTGAAGCGATCCGCCACGATCGAGAACCAGGGTTTATGTCTGATTTCTTCCGTGCATTCAACCTTATGGTCG
AAAAAAAACAGAGGGCCACGATGGCCTACCGTCCACAGGCCAACAGAACCGCGGAAAGGATGGTGCAGACGTTGACGCGCGCGCTCAAGATGTACGTTGC
TGATGTGAACCAATGAGACTGGGACGAGTATGCGGAGCGCGTGACATTCGCGATCAACACTGCCCAAGATCGCGTCAGGGGCGACACCCCGCTTTATCTG
ATTCACGGCTGGGACCCGCGTTCGACGTTAGAAGCTTCCTTACCACTGGGCAGTacgcgacgacgagacaGCGAGCCGAGGCAGTGGAGATAtcacgtgc
agcagcagtaccaaAGAGCTAGGGAGCAGGTCAACGAACGCCTACGAGAAGCGATTCAAGGCAGGGCAGACCGCCATAATGGAGAGATCAGGCCGCACTT
GATTCAGGCTGGCGCGCAGGTTTGGTTGTACCTGGATCGGGTGAAAGAAGGCTACGCGCGCAAGTTGGCACATATGTGGCACGGGCCATTTCGGGTGGTG
GAGATGGTGGGGAGTCACGCGGTGCGGTTGGAGACTGCGGGGACGAAGTATCGCCTGTTCCCAGTCGTGCATGTGTCCAAATTGAAAAGAGTTCGGGCGT
TTCCGGATCGCCCGGATGTAGAATTAACAGTGGATGAGAGTGCCCGtgtcgacttcgacgaggcccTCCTACCCGAAGATAGCTGGGAACGCAACCttga
cgaggacgagtaTGAGGTCGAACGGATCGCAGACATGCGAACAGGTCGACGTACTCGGTACGGCCGAGTTTATCGTGAATTCAAAGTATACTGGAAGGGG
TACCACGACCCATCATGGGTGGATGAGGCCGATGTAAATTGTGGCGCCGTGTTACGGGAGTACGAGCGCGGGATGATCGCACGCAACCGCTTCGGAATCA
TGCAATCGCACGAGGAAGCGACGCAGGACTCGTA
	
	
ATGAGAGGCGAGCGGATACGGCAagcgcaaggagaagaaaAGTGGATCGCCGATCTAAAAACGTACTTGAAAGGCGACGTTCAGGAGTTATCCGCCGAAG
ACGCCAGGTCCTGTTCCAAGATCGCAGCTGACTACGAGCTGGATGAGAACAATCTGTTGTTCCTTTGTCCCGCAGTGACGCCGAGGAACGAAGATCGTGA
CGCGGGCAAGTCCCCAGGGAACGTGCGAGCAACGTACCCGTTCCAAATCATTGCGATGGACCACATCCCATCGTTGCCGAAGTCTTTCAAGGGGAACACA
GAGTTGCTGGTTTGGGTCGACCTGTTCTCGGGCTACGTGATCGCCAAAGCAAGCGCCTCGCGCACGGCTCAGACCATCGCAGAGAACTACGAGGAATGCG
TGTTCCGACGTTTTGGGGCCAGTGAAGCGATCCGCCACGATCGAGAACCAGGGTTTATGTCTGATTTCTTCCGTGCATTCAACCTTATGGTCGAAAAAAA
ACAGAGGGCCACGATGGCCTACCACTGGGACGAGTATGCGGAGCGCGTGACATTCGCGATCAACACTGCCCAAGATCGCGTCAGGGGCGACACCCCGCTT
TATCTGATTCACGGCTGGGACCCGCGTTCGACGTTAGAAGCTTCCTTACCACTGGGCAGTacgcgacgacgagacaGCGAGCCGAGGCAGTGGAGATAtc
acgtgcagcagcagtaccaaAGAGCTAGGGAGCAGGTCAACGAACGCCTACGAGAAGCGATTCAAGGCAGGGCAGACCGCCATAATGGAGAGATCAGGCC
GCACTTGATTCAGGCTGGCGCGCAGGTTTGGTTGTACCTGGATCGGGTGAAAGAAGGCTACGCGCGCAAGTTGGCACATATGTGGCACGGGCCATTTCGG
GTGGTGGAGATGGTGGGGAGTCACGCGGTGCGGTTGGAGACTGCGGGGACGAAGTATCGCCTGTTCCCAGTCGTGCATGTGTCCAAATTGAAAAGAGTTC
GGGCGTTTCCGGATCGCCCGGATGTAGAATTAACAGTGGATGAGAGTGCCCGtgtcgacttcgacgaggcccTCCTACCCGAAGATAGCTGGGAACGCAA
CCttgacgaggacgagtaTGAGGTCGAACGGATCGCAGACATGCGAACAGGTCGACGTACTCGGTACGGCCGAGTTTATCGTGAATTCAAAGTATACTGG
AAGGGGTACCACGACCCATCATGGGTGGATGAGGCCGATGTAAATTGTGGCGCCGTGTTACGGGAGTACGAGCGCGGGATGATCGCACGCAACCGCTTCG
GAATCATGCAATCGCACGAGGAAGCGACGCAGGACTCGTAG
	
	
MRGERIRQAQGEEKWIADLKTYLKGDVQELSAEDARSCSKIAADYELDENNLLFLCPAVTPRNEDRDAGKSPGNVRATYPFQIIAMDHIPSLPKSFKGNT
ELLVWVDLFSGYVIAKASASRTAQTIAENYEECVFRRFGASEAIRHDREPGFMSDFFRAFNLMVEKKQRATMAYHWDEYAERVTFAINTAQDRVRGDTPL
YLIHGWDPRSTLEASLPLGSTRRRDSEPRQWRYHVQQQYQRAREQVNERLREAIQGRADRHNGEIRPHLIQAGAQVWLYLDRVKEGYARKLAHMWHGPFR
VVEMVGSHAVRLETAGTKYRLFPVVHVSKLKRVRAFPDRPDVELTVDESARVDFDEALLPEDSWERNLDEDEYEVERIADMRTGRRTRYGRVYREFKVYW
KGYHDPSWVDEADVNCGAVLREYERGMIARNRFGIMQSHEEATQDS_