Scaffold : Scaffold_332
Gene_id : Phypl_g7084
Description : hypothetical protein PHYSODRAFT_256009
ATGGTCGACACGGTGGCCAAGCCGACGCGGAAGCGCGGGCGCGGCGTGGGCCCGCGGCTCaacgacctgcagcgcctggagaTCATCCACAAGCATAAGA
GCTCGCAGCCGCCGACCTCCttgcgccagctcgcgcgcgacttcggcgtggacgagaagtCCATCCGCCGGGTCGTCAACGCGGCCGCGGACATTGaggc
gcgcgccagctcgtccgcggCCTTAAACAGGAGGTCGCACGTGCACCGCCGCCCCACGCCGCGCTTcccgcagctggagaagacgctgtcggccTGGATC
GACGCCCGGGAGCGGGCGAAGGCCGACATCTCGCCCTCCGTGGTCAtcgacaaggccaagttGGTGGCGCGAGCCATGGGCATCAGCCCGGACGACTTCA
AGGCCAGTTGGGGCTGGTACGACAAGTTCAGCAAGAGATACGGCATCCACACGGCCTTCGTGAGCAGCGGAGGGGGCGAGGGGGACAGGAAGCCACTCAG
AGAGACCACGAgtctgcaggagctgcaccgGGTGATGACGCAGTACGACCCCGAGTGGGTCTTTACAGTTGAAGAAACGTCGTTGTTTTATGACGCGCTG
CCTTTTGGTGCAGACGCGGGGGGGAACAGGAAGCGAGTGACActcgtgctgtgctgcaacTCGACCGGACGGGTGACGCTGCCCGTCTGCATGGTCGGGA
AGGACTCCTCGTGTGGACGCaacgcggcgtccagcttccCGCTGCCGTACTTGGAGCAGAACAGGGCGTGGCTGGATCGACCGACGTTCGGAAGCTGGTA
TAGCTCCGTGTTCGTGCCGTTTGTGCGCGAACGCACGAGTAAaccggcgctgctggttgtggaTGGAGAACGCCCCGGACACCAAGGGAACTTTGAAGAC
GACAGCGTTCGACTGGCGTTCTTGCCGGCGACACAGGCTCCGACTGAGACAGTAACGGCTGCGAAGATGACGAATCCGAAGACTTGGTGGAGTAGGCCGT
TGGGGGTGGGtgtcgtggtggcgctcaAGGCGAAGTATAAGTTTCTGCTCGTACAGAGCGTGCTGTCGTACCACAACGCTCCAgaggaggtgaaggtggC
CCTCAAGGCAGCGGAAGAAAGAGACAACCGTCATGGAGGCGGCGTGCATTTCGGCCGCGCACCGACATTGCTGGACGCTGCACGGTTGCTGGAACAGGCC
TGGGGCCAGGTGCCTGATGGTTTATTGCAAAACTGCTTCGCGCGTGCTAACTTGATCCCGCCATCAAAGTTGTTGGCACCTTCCGCTCCTCCAACGGGGA
TGAGTGCTCTAGAGGAGCAGACTCAGGAATCGATGCGCTATAACGATGAGATTGCTGGCAAGATtgaggagatgctgctgccaagctcCCTCGATGCTCG
TGTCTGGGCCATGAACGAGCAGCATCCACCAGCTAATCTAAGGGATCGCATTCGAGCGTTCATGCACCTGGATGATGAGAACTCATTCGAGCTGCGGAGG
CAACTACAAGGCGAGATTAACGAAGCTCTGAGTGATGTGGTTCCGTCGGCGCCAGCATCCGATTCGATCATACCAGCTCCTAGTATCGATACAAGTGACA
GCGATATCGGTGAGGCCGATCCGGAAAAACCCGACTTGCAGTCCCAAATTCGTGGAGTACTGCTTGGCATCACGGAAGTTGCCTCGCGGCTACGGCTGTT
ACCGCGAACTGGTGCCGACACGGCGAAAATGGCGCCACTCCAACTCGAGGGATGCATAGCAGCAGCCGACCAGATCCGGCATTGCGTCCAAGCTTTCGAC
AACAATCTCCACGGAGAAAGCAGGCGAGACGAGCAGACCCCAAGCACGAAGAAGGCAGCCAGAAAGCCAGGAACAGACCTCGCACTGAGCGGCGATAAGA
CTTTAGTGTA
	
	
ATGGTCGACACGGTGGCCAAGCCGACGCGGAAGCGCGGGCGCGGCGTGGGCCCGCGGCTCaacgacctgcagcgcctggagaTCATCCACAAGCATAAGA
GCTCGCAGCCGCCGACCTCCttgcgccagctcgcgcgcgacttcggcgtggacgagaagtCCATCCGCCGGGTCGTCAACGCGGCCGCGGACATTGaggc
gcgcgccagctcgtccgcggCCTTAAACAGGAGGTCGCACGTGCACCGCCGCCCCACGCCGCGCTTcccgcagctggagaagacgctgtcggccTGGATC
GACGCCCGGGAGCGGGCGAAGGCCGACATCTCGCCCTCCGTGGTCAtcgacaaggccaagttGGTGGCGCGAGCCATGGGCATCAGCCCGGACGACTTCA
AGGCCAGTTGGGGCTGGTACGACAAGTTCAGCAAGAGATACGGCATCCACACGGCCTTCGTGAGCAGCGGAGGGGGCGAGGGGGACAGGAAGCCACTCAG
AGAGACCACGAgtctgcaggagctgcaccgGGTGATGACGCAGTACGACCCCGAGTGGGTCTTTACAGTTGAAGAAACGTCGTTGTTTTATGACGCGCTG
CCTTTTGGTGCAGACGCGGGGGGGAACAGGAAGCGAGTGACActcgtgctgtgctgcaacTCGACCGGACGGGTGACGCTGCCCGTCTGCATGGTCGGGA
AGGACTCCTCGTGTGGACGCaacgcggcgtccagcttccCGCTGCCGTACTTGGAGCAGAACAGGGCGTGGCTGGATCGACCGACGTTCGGAAGCTGGTA
TAGCTCCGTGTTCGTGCCGTTTGTGCGCGAACGCACGAGTAAaccggcgctgctggttgtggaTGGAGAACGCCCCGGACACCAAGGGAACTTTGAAGAC
GACAGCGTTCGACTGGCGTTCTTGCCGGCGACACAGGCTCCGACTGAGACAGTAACGGCTGCGAAGATGACGAATCCGAAGACTTGGTGGAGTAGGCCGT
TGGGGGTGGGtgtcgtggtggcgctcaAGGCGAAGTATAAGTTTCTGCTCGTACAGAGCGTGCTGTCGTACCACAACGCTCCAgaggaggtgaaggtggC
CCTCAAGGCAGCGGAAGAAAGAGACAACCGTCATGGAGGCGGCGTGCATTTCGGCCGCGCACCGACATTGCTGGACGCTGCACGGTTGCTGGAACAGGCC
TGGGGCCAGGTGCCTGATGGTTTATTGCAAAACTGCTTCGCGCGTGCTAACTTGATCCCGCCATCAAAGTTGTTGGCACCTTCCGCTCCTCCAACGGGGA
TGAGTGCTCTAGAGGAGCAGACTCAGGAATCGATGCGCTATAACGATGAGATTGCTGGCAAGATtgaggagatgctgctgccaagctcCCTCGATGCTCG
TGTCTGGGCCATGAACGAGCAGCATCCACCAGCTAATCTAAGGGATCGCATTCGAGCGTTCATGCACCTGGATGATGAGAACTCATTCGAGCTGCGGAGG
CAACTACAAGGCGAGATTAACGAAGCTCTGAGTGATGTGGTTCCGTCGGCGCCAGCATCCGATTCGATCATACCAGCTCCTAGTATCGATACAAGTGACA
GCGATATCGGTGAGGCCGATCCGGAAAAACCCGACTTGCAGTCCCAAATTCGTGGAGTACTGCTTGGCATCACGGAAGTTGCCTCGCGGCTACGGCTGTT
ACCGCGAACTGGTGCCGACACGGCGAAAATGGCGCCACTCCAACTCGAGGGATGCATAGCAGCAGCCGACCAGATCCGGCATTGCGTCCAAGCTTTCGAC
AACAATCTCCACGGAGAAAGCAGGCGAGACGAGCAGACCCCAAGCACGAAGAAGGCAGCCAGAAAGCCAGGAACAGACCTCGCACTGAGCGGCGATAAGA
CTTTAGTGTAG
	
	
MVDTVAKPTRKRGRGVGPRLNDLQRLEIIHKHKSSQPPTSLRQLARDFGVDEKSIRRVVNAAADIEARASSSAALNRRSHVHRRPTPRFPQLEKTLSAWI
DARERAKADISPSVVIDKAKLVARAMGISPDDFKASWGWYDKFSKRYGIHTAFVSSGGGEGDRKPLRETTSLQELHRVMTQYDPEWVFTVEETSLFYDAL
PFGADAGGNRKRVTLVLCCNSTGRVTLPVCMVGKDSSCGRNAASSFPLPYLEQNRAWLDRPTFGSWYSSVFVPFVRERTSKPALLVVDGERPGHQGNFED
DSVRLAFLPATQAPTETVTAAKMTNPKTWWSRPLGVGVVVALKAKYKFLLVQSVLSYHNAPEEVKVALKAAEERDNRHGGGVHFGRAPTLLDAARLLEQA
WGQVPDGLLQNCFARANLIPPSKLLAPSAPPTGMSALEEQTQESMRYNDEIAGKIEEMLLPSSLDARVWAMNEQHPPANLRDRIRAFMHLDDENSFELRR
QLQGEINEALSDVVPSAPASDSIIPAPSIDTSDSDIGEADPEKPDLQSQIRGVLLGITEVASRLRLLPRTGADTAKMAPLQLEGCIAAADQIRHCVQAFD
NNLHGESRRDEQTPSTKKAARKPGTDLALSGDKTLV_