Scaffold : Scaffold_332
Gene_id : Phypl_g7083
Description : hypothetical protein PHYSODRAFT_518543
ATGGCTCCAGGTGAGCCGCGAAGGAGCAAAACGTCGCTAGAATAGCTGCTGATTCAACGCCGTCACTGCCGTAGCAGGTCGCGtgcgcaaggagctggag
gagtgCCAGAAGGACTCGCACCTGTCGGGCGTCACGGCCGTGCCGGTGGACGCCGAGTCGCTctcggagctgcgcggcTCTATCCAGGGGCCCGAGGCGA
CGCCGTACGAGGGCGGCcacttcgagctggagatcgtCATCCCGCCCAAGTACGtaactcgctgctgcatctgcggGCTTAATTGCTAGGTTTTAGATGC
TAATTCGTTGCTACCGGGGAACTTATTTAGGTACCCATTCGAGCCGCCGCAGATGCGCTTCCTCACCAAGATCTGGCACCCCAACATCTCGTCGCAGACG
GGGGCCATCTGCCTGGACATCCTCAAGGACGCGTGGTCTCCCGCGCTGACCatcaagacggcgctgctgtccatccaggcgctgctctcggcaGCTGAGC
CCACGGACCCGCaggacgccgaggtggccaagatgtacctccacgaccacgagcagTTCCTCAACACTGCGCGCTTCTGGACCGAGAGTTACGCCAAGCA
GACGGACacaggcgacgacgccgcgctctccAGACTCATGGACATGGGCTTCCCCGCTGTACGGGGGCTGCAATGTTTTAATTATTTTTTTCTCGAGATG
ATAGCGCTGAACAACACCATGTTTTGCTTCGTTATGCTGCAGGACAAGGCGAAGGCTGCACTGCAGGCGGCCAATGGCGATGAGAACGCTGCGATCGAAA
AgttggtcagcagcatgtA
	
	
ATGGCTCCAGGTCGCGtgcgcaaggagctggaggagtgCCAGAAGGACTCGCACCTGTCGGGCGTCACGGCCGTGCCGGTGGACGCCGAGTCGCTctcgg
agctgcgcggcTCTATCCAGGGGCCCGAGGCGACGCCGTACGAGGGCGGCcacttcgagctggagatcgtCATCCCGCCCAAGTACCCATTCGAGCCGCC
GCAGATGCGCTTCCTCACCAAGATCTGGCACCCCAACATCTCGTCGCAGACGGGGGCCATCTGCCTGGACATCCTCAAGGACGCGTGGTCTCCCGCGCTG
ACCatcaagacggcgctgctgtccatccaggcgctgctctcggcaGCTGAGCCCACGGACCCGCaggacgccgaggtggccaagatgtacctccacgacc
acgagcagTTCCTCAACACTGCGCGCTTCTGGACCGAGAGTTACGCCAAGCAGACGGACacaggcgacgacgccgcgctctccAGACTCATGGACATGGG
CTTCCCCGCTGACAAGGCGAAGGCTGCACTGCAGGCGGCCAATGGCGATGAGAACGCTGCGATCGAAAAgttggtcagcagcatgtAG
	
	
MAPGRVRKELEECQKDSHLSGVTAVPVDAESLSELRGSIQGPEATPYEGGHFELEIVIPPKYPFEPPQMRFLTKIWHPNISSQTGAICLDILKDAWSPAL
TIKTALLSIQALLSAAEPTDPQDAEVAKMYLHDHEQFLNTARFWTESYAKQTDTGDDAALSRLMDMGFPADKAKAALQAANGDENAAIEKLVSSM_