Scaffold : Scaffold_467
Gene_id : Phyra_g11769
Description : hypothetical protein
ATGGCGAAAGAAGCGAAGTCAGTGGTACCAGCAACGCCGGCGAGGTCAAGTGGAACGCGTACCGAGGGTTCGGGGCGTTCCGGTTCGTCCTTTGCGACGC
CGAGTACGTTGGCGTCGATCAACGAGCGTTCGGACAGTTTTGATGAGCCGATGGACTATTCTGACGCCAAGGAAGATGACGACGAAGATGACCTGGAAGA
GAAGGCAGCTATGCCCGAGCTTTCGGAAGCCGCTGCAGTATCTGCAGGACGCAGCGGAGGGGTGAGGTCGCTTGCGCGAAACCTCACCGAAGAGTTGAAC
GAAGTGGGTGGTCCCGAACCAGCCAACGGTTACGACGAAGATGAGTCCGACGATCACCGATCGTCGACGATGGCCGAGGATGCGAATTCTCGGCCGAATG
GCGGCCGGCCTCCTCTTAACGGAGACACCCCGGCCGCCAACCGAGTTCTGGGTCGATACCTAGAACTCATGAAGGTGAAGAGCAACTGGATGCGATCCTT
CGCTCCAGAGGTTGTTCGCCAAGCCATCTGGATGGAGCTCGGTGGCGAGTTAACTGTGCCCGTGGAGTCGTGGAATACTCGGCAGGTGGCCGAGGACACG
GTGCAACTCCTACGCGCTATGGGATGTGAACCCCAAGTGTTCCCGTCGGAAGCAGACCTCCGAGCATGGGCACCCGAGGACGCCGCTACGGCGCTTCGCA
AGTGGAAGCAGAAGCTTCGGTCGGCCTTCGGGGTGGCCGAGGCGGGAGTTAGCCGTCCACCGAACGTCCGCCACGCATCGGATCCGGTCGACCCGTCCAT
GATTCCGTTACCATTGACCCCTGGGAGACGCCCCAGAGAGTCGACCGAGACCGGAATTTTTTCGGCCAAGGGAGCGACCTCGACATATTTCCAAGACTCT
CACATGGTGACGCCGAGGTCGGTCAGTCGTACAGAACGACTGGCGAGAGAGGCCGAGGGATATCGAACCGCTCCGACTGCTGGACGAAGTGCAAGTCGGA
CGCCCAGCCGACGTTACGACCTCCGCGATGACTCATCTGACGAAGATTCGTTCGACGTCGGAGACACCGGGGGTGACTTGACGGGAGAATGGGCACGCCA
AATTCGTGAGCTGAGCGCTGTGGAAAATGACAGTGCGACACCGAGGCTAGAGATCGCTACGCATCTCCCACTCGGAAACATCAAGCCGTACTTGGGACTC
CGCGATAAGAGCGAGAAGTCCATGCAGTGGCTCCGAGCGTTCATATACGAGATGAAAGGGACGCACACGCCGCCTAACGAATGGTGCATGGCGTTTGAAT
TGAGCCTCCAAGATGGTGCTCTGCATTGGTACCGACAGCTGCCCCGCAAAACGAGACGCACGTGGAAATTGTTGAGCGATGCGTTCATTAAGTACTACTG
TTCGAGGTTCAACCAGTCTGCGAAGGCTCGGTACTACTCGGCCAAGCGAGAGGAGAAGGAGCATGTCTGCGACTACCTCAACCGACTTAACGGCTATGCT
CGCAACGCCGGAGTGCAGTTCGAGCATGGCGGTCGTGATGCAAAGGACCACGTCGAGCATTTCTTGGATTCGTGCGAAGACCGAGGCCTAGAAGAGCGTC
TGTGCCATGTCCGAGTTAAGAACATTCACGACCTCGAGGATATGATCAATGATATCCTTCGTCGCAGAGAGCGAAAATCTGGACGCGAGTCCTCGGTCCG
CCGCCCTCGAGGGCAAGAGGTAGCACGCCGACGCGATGGTGGACGCTCCGAGGATCCGCGGGACGGCTATCGCCGAGACCGACGTCACCGAGAGGACGAC
CGTCGTCGAGAAGACCGTTACCGAGACGATAACCGTCGCCGGGATGACTAACAATATCGACCGAGGGTCACACTCACTGACGCACTGACCAACATAGTGA
CAGCACTGAATGCGGGACGCACGGTGGACGCGCGTGGAGGATACCCGGAAGCGTACAACGACGGATATGATGACACCGAAGAGTATAGGCCGGAGTCTCA
CTCTGGCGATGACGACCGATACCCCGAAGGGTACTCGGACGACGGATACGCGTCGACCGAGGACCGAGGCCACGTGGCTGCTGCAAACGACTCTGAACGT
CGCAATGCGGCTGAAGGAACGTTCGCTCGCGCCGACAGCCGTCGGCCGAGGGCAAGTAACGGTCAACGCCCGTATGACCGAGACGACCAGCGCCGAAACT
CCACCGGACGCGATGGTCGACGCCAATATGGTCCATGCGCCGCCTGCGGAGGACTCACCCATTCGGCTCACTACTGCTTTAAGCGATGCAAGATGTGCAA
ACAGGTTCATGATGCCGGGAAGTGTGAAGCCTTCCAGGAACTCACGAATCTCCTCCGAGCTAAGGTCGAGAAGAAGGACCTCTCGCCGGAATTGCAGGAA
CTCGTCTATGGGAGTCATTTAAACTAGGCAGCCCGCCAACTGAAACTGGGTTGGTCCCAATCGGGCTGCCACAGTTAGCCAAACCTGCGCTGGATGCGGA
CTATATGTTCGAATTCGCAGGTGTGAGCAACGGCCTGATGACTTGAATATGGAATATGTGAAAACGACGGAAAATGTAAAGGAGAGAGACGTAAGCCTCG
GTGAGAGTGAAGTGGATGGACGACGTGTGGACGGAGACGGAGTGGAGCTAACCGATGCTTCGATCCTTAGCATGGCCAAAATCGACCATCCATCCCGAGA
CCTCGGCCAGACGATTAAACTGTTATCTGGCGAGAGAATGGGGTGGTGGTCATCCCAGCGCTATGACAAGAGGAAGCGATTGCGAGCCCTCGTCAATGGG
GCTGTAAACGACTCGCGAACGAGGATTCTGCTGGACACTGGAGCGAATGTCAGTGTGATTTCCGCGTCATACGCGAAACGGTTGCGCTTGCGCGAAGTTC
CAGACCACGGTAGGAGTCTGGAAGTGCGAGGAATTAACCCAGGGGTGATGGAGACCCGCAGACGAGCACTCGTTAAAGTCACGCTAGGCTGGGAGCGCGT
GTACGAATTTGAAGTATGGGTTATGGATCACAGTGCAGGAGTGGACGTGGTCCTGGGAACAGACTTCATGATTCCAGCCGGAGTCCGGTTGGATCTGTTC
CACGGTACTGCGAGACTACCGGACGAGGTAATGGTGCCCCTGGTGAAGTCGCAGAACCCAGCAGAGGCCGAGCCGTACAGCATGCAAGTGACTGGACGCC
CGACCGAAGATTTGTCGGTCCCAGGGCGTGAGTGGCGAGAATTTAGGTTACCACGACGACGGCCGCCTCTGACTACTCACGACGTGTGGGCACGCCGGAT
TGGAAACCTGGTGCCCACTGTAACGAGGTCTCGACGAGGGCAGCCGACGATGGTGCGACTAACGAACGTGTCACCGAAGATTGCTCACTGCGCGAGACAC
GAATCGGTACTGCTGTGGGTGAAAAAGGGTGACCTGCCGCAAGGGGATGGATACACTCGTTTGAACTCCGCTAAGTATGAGGAGTGGCAAGTCCTGGCGT
ACGCGGAGTGTCGAGACGAGACTTTGTTCGCGCGGGAACGCAAACTCTACGAACGATGGTTGGCAGATCAGCCACCAGCTGTAGAACGACGAGACTATCC
GACACCTAGCGGCATCCTACCTCGACCATCCGACGACTTGGAAGGCCTAGACGAGGGCCAGATAACGTTCGCGAATAGGGGCACTGAGGAACCGGCAGAA
CGAGACCGAACGCCGTTGACGACTTCGGTGCAACCCTCTGACGAACCCGTTGGAGATAGATGGGTCGACGAAGATGACGACTCGGTGGCGACCGACACCT
CTGATGGCGCGGATACCACGTATACGAGTGAAGAGAACTCCATCCCAGTCCTCGGTGATGACCCGGAGACCCGATTGGACTCTGCCTTCGTAGCAATGAT
GCATGAGATTGCCGCGGGGGACGGTTCAGGTAGTGGGAACACCGATACCAATACGTCCGAACATTTAGCGAATGAGATCGAGTTGACGGACTATGCACAC
GAGTTGGCGTTCTTACCGGACCTGACCGAAGCCTCGGAAACGGTACTGGATTATTCAGGACCGAATGTTCTGAACCCGAGCGCGACAGCCCGTCAACAAG
AAAGTCTCGTTGCGGTGCTGAAACGACACGAGAAGATCATGATTGCGAGTGGGAATGCTCTGCCACCACCGGCCTACGGTGTGGTGTGCGATATTGACGT
ACAGGGGCATCCACCCATCAAACAGAGAGCTCGGAGAACACCGCTCCGACACCTTCGGAAGCTGTACGAGCTTCTGAAAGGCTTGCTGAAAGCTCGTCTA
GTGGCGTTTTCGGACAGCCCATGGGCGTCGCCCATCGTGATCGTGCTCAAGAAGAATGGAGTTGATATTCGGTTGTGCATCGACTACAAGCTGGTGAATG
CAGTGACGGCGATTATGGAGTACGCCATGCCGTTAGTCGACGACTTGTTGACCGACCTGGAAGCCTACCTATGGTTCTGCTCACTTGATGCGGCCAGTGG
ATTCTGGGCTATTATGATGACGATGCGGGCCCGCAAAGTCTCGGCATTCGTCTGTGCACTCGGACATTTCGAATGGCTTCGTATGCCGTTTGGATTGAAG
AATGCACCGATGATTTACCAACGAATGATTGACAATGCTCTGTGGGGTTTCGTCCAACCCAAAGGCGGCTGGCTCCACTTTTCGGAGCTTATGCGAACGG
CCGAAGCCCACGCCGAGGTTGCGCGGACAGGGGTGACCGACCCTTCATCGCGACGACTCGAGGAGTCAACAACTCGGGTGACCAAATTCGAGGCCGACCG
CGAATCCTCGGTCACGCTTGACGCAGTGAATGGGTTAGTGAACAGCCCTGTTGCCGACATGTTCTCCACCGGAGAACCGGATGAATCCTCGTTGGTGCCA
GTGTTCGACCGACGGTCGTTTGTCGATGATATCTGTTTTGGGTCCGAGACTTTCGACGCGTGCCTGGAGACGTTAGACCGACTGCTCCAACGGTTCACCG
AATGTCGCATTAGTGTGAGCTTTACGAAGAGTATCTTCGTCCAGCCAAAGGTGGATTTCCTGTCACACGAAGTCTCTGCAGAAGGTATTCGAGCCGACAC
CAAGAAGATGAAAGCAGTGACCGAGCTGCCATTCCCTGCTTCGAAAAAGGGGATGCAGTCTTTCCTCGGTGCGCTGAATTATTACAGTCGATTCATCCAG
GACTTCGCAGTGTATGGAGCAGCTTTGTATCAGTTGAAGGATGAAGACTTCACGCCTAGTGGCAGCCTCTCGGCGGCCAAGCGAAGCTTCGCGGCGCTCC
AACAGAAGGTTGCAGAGGCACCGATCCTCCGGCACTTTGACCGAGACAAGGAGGTGCATGTCACGTTATTCACGAATGAGTGGGCATTGAGCTCCACTTT
GATGCAATACCATGATGACAAGCTGCACCCGGTTCGATTTTGTGGCCGAGTCCTCAAGGACGCCGAGATGAACTACCACCCGGCCGAGAAGGAGGTCTTA
GCGCTACTGCTGGTGTTGAAAGTGTGCTACTCCCAGTTGGTGGGTCGGACCATCCGCGTCTATACGCGTTTTTCGACGCTCGAATGGGTGCACAAATCCA
AGACACTGTTCGGTCGAGCGACCCACTTTGCGGTTATGTTGTCCCCGTGGCACCTGGTGGTCAACCGAGTCAAGGAACGCGATTGCACGTTTGCTCAGCT
TCTCCAAGCTGGCCTCACAAGCTTCGTGGAGTTGGAAGACTCGTTGGCCCCAGTTACACCGCCGACGAAAGGGTCACCTACTGCTCGTATGGACCCCCAC
TTGCTTTATGCCTGCCTACCGAGGTCCTATACCGGATTGGTGATGTCGTTCGATGGTTCGGCCAAGACCGAAAAGAACGGTGGATACGGCAGTTGCTCAT
GGATTTTGTGGAAATTACCAGAATGGACTGTAGTGACGGCTGCGAGTGCTTATCTCGAGACCACCACGGTAAACCTCGCTGAGTATGCTGGAATGAACAA
CGGCGTCTCAGCTGCGCTCGAACATGGAGCCGAGGATTTAGTCATCGTGGGAGACTCGAGACTCGCAATCCAGCAGTCCCTAGGGGTGATGGCATGTCGA
AAGGAGTCTCTGATGGTACAACTGAATCGTCACCGAGAGCTCACGACCAAGCTGCGGTCAGTGAAGTATCTGCACGTGGTCCGAGAGTTCAACGCTGCAG
CAGATTCGTTGGCAGGCGAGGCTCTCAGCAGCAAAGAATCCAGCGTAGCTTCGACCGAGGCTAGGAAATTAGAATTGGTCGAGCTGAACCGGATCGGAGA
GGTCATCTATGAACCCTCAGTACAGACCACGGCCGAAGAGAAACCGACAGTCAGCTTCGCCCGAGCCAAGT
	
	
ATGGCGAAAGAAGCGAAGTCAGTGGTACCAGCAACGCCGGCGAGGTCAAGTGGAACGCGTACCGAGGGTTCGGGGCGTTCCGGTTCGTCCTTTGCGACGC
CGAGTACGTTGGCGTCGATCAACGAGCGTTCGGACAGTTTTGATGAGCCGATGGACTATTCTGACGCCAAGGAAGATGACGACGAAGATGACCTGGAAGA
GAAGGCAGCTATGCCCGAGCTTTCGGAAGCCGCTGCAGTATCTGCAGGACGCAGCGGAGGGGTGAGGTCGCTTGCGCGAAACCTCACCGAAGAGTTGAAC
GAAGTGGGTGGTCCCGAACCAGCCAACGGTTACGACGAAGATGAGTCCGACGATCACCGATCGTCGACGATGGCCGAGGATGCGAATTCTCGGCCGAATG
GCGGCCGGCCTCCTCTTAACGGAGACACCCCGGCCGCCAACCGAGTTCTGGGTCGATACCTAGAACTCATGAAGGTGAAGAGCAACTGGATGCGATCCTT
CGCTCCAGAGGTTGTTCGCCAAGCCATCTGGATGGAGCTCGGTGGCGAGTTAACTGTGCCCGTGGAGTCGTGGAATACTCGGCAGGTGGCCGAGGACACG
GTGCAACTCCTACGCGCTATGGGATGTGAACCCCAAGTGTTCCCGTCGGAAGCAGACCTCCGAGCATGGGCACCCGAGGACGCCGCTACGGCGCTTCGCA
AGTGGAAGCAGAAGCTTCGGTCGGCCTTCGGGGTGGCCGAGGCGGGAGTTAGCCGTCCACCGAACGTCCGCCACGCATCGGATCCGGTCGACCCGTCCAT
GATTCCGTTACCATTGACCCCTGGGAGACGCCCCAGAGAGTCGACCGAGACCGGAATTTTTTCGGCCAAGGGAGCGACCTCGACATATTTCCAAGACTCT
CACATGGTGACGCCGAGGTCGGTCAGTCGTACAGAACGACTGGCGAGAGAGGCCGAGGGATATCGAACCGCTCCGACTGCTGGACGAAGTGCAAGTCGGA
CGCCCAGCCGACGTTACGACCTCCGCGATGACTCATCTGACGAAGATTCGTTCGACGTCGGAGACACCGGGGGTGACTTGACGGGAGAATGGGCACGCCA
AATTCGTGAGCTGAGCGCTGTGGAAAATGACAGTGCGACACCGAGGCTAGAGATCGCTACGCATCTCCCACTCGGAAACATCAAGCCGTACTTGGGACTC
CGCGATAAGAGCGAGAAGTCCATGCAGTGGCTCCGAGCGTTCATATACGAGATGAAAGGGACGCACACGCCGCCTAACGAATGGTGCATGGCGTTTGAAT
TGAGCCTCCAAGATGGTGCTCTGCATTGGTACCGACAGCTGCCCCGCAAAACGAGACGCACGTGGAAATTGTTGAGCGATGCGTTCATTAAGTACTACTG
TTCGAGGTTCAACCAGTCTGCGAAGGCTCGGTACTACTCGGCCAAGCGAGAGGAGAAGGAGCATGTCTGCGACTACCTCAACCGACTTAACGGCTATGCT
CGCAACGCCGGAGTGCAGTTCGAGCATGGCGGTCGTGATGCAAAGGACCACGTCGAGCATTTCTTGGATTCGTGCGAAGACCGAGGCCTAGAAGAGCGTC
TGTGCCATGTCCGAGTTAAGAACATTCACGACCTCGAGGATATGATCAATGATATCCTTCGTCGCAGAGAGCGAAAATCTGGACGCGAGTCCTCGGTCCG
CCGCCCTCGAGGGCAAGAGGTAGCACGCCGACGCGATGGTGGACGCTCCGAGGATCCGCGGGACGGCTATCGCCGAGACCGACGTCACCGAGAGGACGAC
CGTCGTCGAGAAGACCTGACAGCACTGAATGCGGGACGCACGGTGGACGCGCGTGGAGGATACCCGGAAGCGTACAACGACGGATATGATGACACCGAAG
AGTATAGGCCGGAGTCTCACTCTGGCGATGACGACCGATACCCCGAAGGGTACTCGGACGACGGATACGCGTCGACCGAGGACCGAGGCCACGTGGCTGC
TGCAAACGACTCTGAACGTCGCAATGCGGCTGAAGGAACGTTCGCTCGCGCCGACAGCCGTCGGCCGAGGGCAAGAGTGGACGTGGTCCTGGGAACAGAC
TTCATGATTCCAGCCGGAGTCCGGTTGGATCTGTTCCACGGTACTGCGAGACTACCGGACGAGGTAATGGTGCCCCTGGTGAAGTCGCAGAACCCAGCAG
AGGCCGAGCCGTACAGCATGCAAGTGACTGGACGCCCGACCGAAGATTTGTCGGTCCCAGGGCGGCAGCCGACGATGGTGCGACTAACGAACGTGTCACC
GAAGATTGCTCACTGCGCGAGACACGAATCGGTACTGCTGTGGGTGAAAAAGGGTGACCTGCCGCAAGGGGATGGATACACTCGTTTGAACTCCGCTAAG
TATGAGGAGTGGCAAGTCCTGGCGTACGCGGAGTGTCGAGACGAGACTTTGTTCGCGCGGGAACGCAAACTCTACGAACGATGGTTGGCAGATCAGCCAC
CAGCTGTAGAACGACGAGACTATCCGACACCTAGCGGCATCCTACCTCGACCATCCGACGACTTGGAAGGCCTAGACGAGGGCCAGATAACGTTCGCGAA
TAGGGGCACTGAGGAACCGGCAGAACGAGACCGAACGCCGTTGACGACTTCGGTGCAACCCTCTGACGAACCCGTTGGAGATAGATGGGTCGACGAAGAT
GACGACTCGGTGGCGACCGACACCTCTGATGGCGCGGATACCACGTATACGAGTGAAGAGAACTCCATCCCAGTCCTCGGTGATGACCCGGAGACCCGAT
TGGACTCTGCCTTCGTAGCAATGATGCATGAGATTGCCGCGGGGGACGGTTCAGGTAGTGGGAACACCGATACCAATACGTCCGAACATTTAGCGAATGA
GATCGAGTTGACGGACTATGCACACGAGTTGGCGTTCTTACCGGACCTGACCGAAGCCTCGGAAACGGTACTGGATTATTCAGGACCGAATGTTCTGAAC
CCGAGCGCGACAGCCCGTCAACAAGAAAGTCTCGTTGCGGTGCTGAAACGACACGAGAAGATCATGATTGCGAGTGGGAATGCTCTGCCACCACCGGCCT
ACGGTGTGGTGTGCGATATTGACGTACAGGGGCATCCACCCATCAAACAGAGAGCTCGGAGAACACCGCTCCGACACCTTCGGAAGCTGTACGAGCTTCT
GAAAGGCTTGCTGAAAGCTCGTCTAGTGGCGTTTTCGGACAGCCCATGGGCGTCGCCCATCGTGATCGTGCTCAAGAAGAATGGAGTTGATATTCGGTTG
TGCATCGACTACAAGCTGGTGAATGCAGTGACGGCGATTATGGAGTACGCCATGCCGTTAGTCGACGACTTGTTGACCGACCTGGAAGCCTACCTATGGT
TCTGCTCACTTGATGCGGCCAGTGGATTCTGGGCTATTATGATGACGATGCGGGCCCGCAAAGTCTCGGCATTCGTCTGTGCACTCGGACATTTCGAATG
GCTTCGTATGCCGTTTGGATTGAAGAATGCACCGATGATTTACCAACGAATGATTGACAATGCTCTGTGGGGTTTCGTCCAACCCAAAGGCGGCTGGCTC
CACTTTTCGGAGCTTATGCGAACGGCCGAAGCCCACGCCGAGGTTGCGCGGACAGGGGTGACCGACCCTTCATCGCGACGACTCGAGGAGTCAACAACTC
GGGTGACCAAATTCGAGGCCGACCGCGAATCCTCGGTCACGCTTGACGCAGTGAATGGGTTAGTGAACAGCCCTGTTGCCGACATGTTCTCCACCGGAGA
ACCGGATGAATCCTCGTTGGTGCCAGTGTTCGACCGACGGTCGTTTGTCGATGATATCTGTTTTGGGTCCGAGACTTTCGACGCGTGCCTGGAGACGTTA
GACCGACTGCTCCAACGGTTCACCGAATGTCGCATTAGTGTGAGCTTTACGAAGAGTATCTTCGTCCAGCCAAAGGTGGATTTCCTGTCACACGAAGTCT
CTGCAGAAGGTATTCGAGCCGACACCAAGAAGATGAAAGCAGTGACCGAGCTGCCATTCCCTGCTTCGAAAAAGGGGATGCAGTCTTTCCTCGGTGCGCT
GAATTATTACAGTCGATTCATCCAGGACTTCGCAGTGTATGGAGCAGCTTTGTATCAGTTGAAGGATGAAGACTTCACGCCTAGTGGCAGCCTCTCGGCG
GCCAAGCGAAGCTTCGCGGCGCTCCAACAGAAGGTTGCAGAGGCACCGATCCTCCGGCACTTTGACCGAGACAAGGAGGTGCATGTCACGTTATTCACGA
ATGAGTGGGCATTGAGCTCCACTTTGATGCAATACCATGATGACAAGCTGCACCCGGTTCGATTTTGTGGCCGAGTCCTCAAGGACGCCGAGATGAACTA
CCACCCGGCCGAGAAGGAGGTCTTAGCGCTACTGCTGGTGTTGAAAGTGTGCTACTCCCAGTTGGTGGGTCGGACCATCCGCGTCTATACGCGTTTTTCG
ACGCTCGAATGGGTGCACAAATCCAAGACACTGTTCGGTCGAGCGACCCACTTTGCGGTTATGTTGTCCCCGTGGCACCTGGTGGTCAACCGAGTCAAGG
AACGCGATTGCACGTTTGCTCAGCTTCTCCAAGCTGGCCTCACAAGCTTCGTGGAGTTGGAAGACTCGTTGGCCCCAGTTACACCGCCGACGAAAGGGTC
ACCTACTGCTCGTATGGACCCCCACTTGCTTTATGCCTGCCTACCGAGGTCCTATACCGGATTGGTGATGTCGTTCGATGGTTCGGCCAAGACCGAAAAG
AACGGTGGATACGGCAGTTGCTCATGGATTTTGTGGAAATTACCAGAATGGACTGTAGTGACGGCTGCGAGTGCTTATCTCGAGACCACCACGGTAAACC
TCGCTGAGTATGCTGGAATGAACAACGGCGTCTCAGCTGCGCTCGAACATGGAGCCGAGGATTTAGTCATCGTGGGAGACTCGAGACTCGCAATCCAGCA
GTCCCTAGGGGTGATGGCATGTCGAAAGGAGTCTCTGATGGTACAACTGAATCGTCACCGAGAGCTCACGACCAAGCTGCGGTCAGTGAAGTATCTGCAC
GTGGTCCGAGAGTTCAACGCTGCAGCAGATTCGTTGGCAGGCGAGGCTCTCAGCAGCAAAGAATCCAGCGTAGCTTCGACCGAGGCTAGGAAATTAGAAT
TGGTCGAGCTGAACCGGATCGGAGAGGTCATCTATGAACCCTCAGTACAGACCACGGCCGAAGAGAAACCGACAGTCAGCTTCGCCCGAGCCAAGTA
	
	
MAKEAKSVVPATPARSSGTRTEGSGRSGSSFATPSTLASINERSDSFDEPMDYSDAKEDDDEDDLEEKAAMPELSEAAAVSAGRSGGVRSLARNLTEELN
EVGGPEPANGYDEDESDDHRSSTMAEDANSRPNGGRPPLNGDTPAANRVLGRYLELMKVKSNWMRSFAPEVVRQAIWMELGGELTVPVESWNTRQVAEDT
VQLLRAMGCEPQVFPSEADLRAWAPEDAATALRKWKQKLRSAFGVAEAGVSRPPNVRHASDPVDPSMIPLPLTPGRRPRESTETGIFSAKGATSTYFQDS
HMVTPRSVSRTERLAREAEGYRTAPTAGRSASRTPSRRYDLRDDSSDEDSFDVGDTGGDLTGEWARQIRELSAVENDSATPRLEIATHLPLGNIKPYLGL
RDKSEKSMQWLRAFIYEMKGTHTPPNEWCMAFELSLQDGALHWYRQLPRKTRRTWKLLSDAFIKYYCSRFNQSAKARYYSAKREEKEHVCDYLNRLNGYA
RNAGVQFEHGGRDAKDHVEHFLDSCEDRGLEERLCHVRVKNIHDLEDMINDILRRRERKSGRESSVRRPRGQEVARRRDGGRSEDPRDGYRRDRRHREDD
RRREDLTALNAGRTVDARGGYPEAYNDGYDDTEEYRPESHSGDDDRYPEGYSDDGYASTEDRGHVAAANDSERRNAAEGTFARADSRRPRARVDVVLGTD
FMIPAGVRLDLFHGTARLPDEVMVPLVKSQNPAEAEPYSMQVTGRPTEDLSVPGRQPTMVRLTNVSPKIAHCARHESVLLWVKKGDLPQGDGYTRLNSAK
YEEWQVLAYAECRDETLFARERKLYERWLADQPPAVERRDYPTPSGILPRPSDDLEGLDEGQITFANRGTEEPAERDRTPLTTSVQPSDEPVGDRWVDED
DDSVATDTSDGADTTYTSEENSIPVLGDDPETRLDSAFVAMMHEIAAGDGSGSGNTDTNTSEHLANEIELTDYAHELAFLPDLTEASETVLDYSGPNVLN
PSATARQQESLVAVLKRHEKIMIASGNALPPPAYGVVCDIDVQGHPPIKQRARRTPLRHLRKLYELLKGLLKARLVAFSDSPWASPIVIVLKKNGVDIRL
CIDYKLVNAVTAIMEYAMPLVDDLLTDLEAYLWFCSLDAASGFWAIMMTMRARKVSAFVCALGHFEWLRMPFGLKNAPMIYQRMIDNALWGFVQPKGGWL
HFSELMRTAEAHAEVARTGVTDPSSRRLEESTTRVTKFEADRESSVTLDAVNGLVNSPVADMFSTGEPDESSLVPVFDRRSFVDDICFGSETFDACLETL
DRLLQRFTECRISVSFTKSIFVQPKVDFLSHEVSAEGIRADTKKMKAVTELPFPASKKGMQSFLGALNYYSRFIQDFAVYGAALYQLKDEDFTPSGSLSA
AKRSFAALQQKVAEAPILRHFDRDKEVHVTLFTNEWALSSTLMQYHDDKLHPVRFCGRVLKDAEMNYHPAEKEVLALLLVLKVCYSQLVGRTIRVYTRFS
TLEWVHKSKTLFGRATHFAVMLSPWHLVVNRVKERDCTFAQLLQAGLTSFVELEDSLAPVTPPTKGSPTARMDPHLLYACLPRSYTGLVMSFDGSAKTEK
NGGYGSCSWILWKLPEWTVVTAASAYLETTTVNLAEYAGMNNGVSAALEHGAEDLVIVGDSRLAIQQSLGVMACRKESLMVQLNRHRELTTKLRSVKYLH
VVREFNAAADSLAGEALSSKESSVASTEARKLELVELNRIGEVIYEPSVQTTAEEKPTVSFARAK