Scaffold : Scaffold_1
Gene_id : Phyra_g25
Description : KUF87205.1 hypothetical protein AM588_10002505 [Phytophthora nicotianae
TGGCTCGCGTCGTTCGCGCCTTCCAAGAAGGCAAGGACTGGAATGAGGTGGCCACTGCCAACGACGTCAACTACCATACTGCTCGCCGAGCCGTCCACGC
TGCCGGCGCGGAACCCAAGCAGCGCGGCGGCTTACGCCCTTCTTCAGTCAAAATGACGGTGGAGGTCATGAGCAAGCTCGAGGAGCTGATCGACGAGGAT
TGCCGCATGACACTGGAGCAGCTACGCGACCGTCTCCACTCCGACCTTGGCGTCGATGTCAGTGTGGCGTCAGTGCATCGCGCACTCCAGGGCATGCTTT
ACTCGACGAAGCGCCTGCGCATCGAGAAGGAGACGATGAACTCAAGCGTCAACAAGGAGAAGCGCAAGGCCTTTGTCGCAGAGTTGAACAAGCACATCAA
GAAGGGTAACATGGTGGTGTTTCAAGAGACTAACTTCAATTTATATTTATCTAGAAATGAATGTTGGTCGCGCATTGGAGAGCGCACTGTAGTCCAGCTG
CCGCCATCAAAAGACAGCAACCTGCACGTCCAAGGCGGCGTCTCAAGCGGGTTCGGGTTGGTACTACTGCAGACTCGTGAGGGCTCTGTCAAGAAGCAAG
AGAATGCGCGCTTCATGGCGGATCTTTTCGTCGCTGCTCTCCGATCGGAGGAGTACGAGGAGCTGCAGCCAGCCAAGGTAGTGATCGTGACTGACAACGC
GCCTGCGCACAGCGAGGTGGAGAGGCTGGCGCGCGAGTACCTGGCCGCGGATGGCATCGTGAACCTGAACAAGTTCGTCGTCCTGCGCCTAGGCCCCTAC
AGTCCGATGCTGAACCCCATCGAGGGGTGCTGGAACTCGCTTAAAGCTAAAATGCGTCGGTTCATGGCCGAGAGAAAGGAAGAGTTTTTGGTGCGTGGTG
AATATGTCACGTTCACGGAGCACCGCATGCAGTTGATGAAGGAGGTAGTGGAGTTTGGCAAGACGGTGATTACTGCGCGACTTGTGTG
	
	
TGGCTCGCGTCGTTCGCGCCTTCCAAGAAGGCAAGGACTGGAATGAGGTGGCCACTGCCAACGACGTCAACTACCATACTGCTCGCCGAGCCGTCCACGC
TGCCGGCGCGGAACCCAAGCAGCGCGGCGGCTTACGCCCTTCTTCAGTCAAAATGACGGTGGAGGTCATGAGCAAGCTCGAGGAGCTGATCGACGAGGAT
TGCCGCATGACACTGGAGCAGCTACGCGACCGTCTCCACTCCGACCTTGGCGTCGATGTCAGTGTGGCGTCAGTGCATCGCGCACTCCAGGGCATGCTTT
ACTCGACGAAGCGCCTGCGCATCGAGAAGGAGACGATGAACTCAAGCGTCAACAAGGAGAAGCGCAAGGCCTTTGTCGCAGAGTTGAACAAGCACATCAA
GAAGGGTAACATGGTGGTGTTTCAAGAGACTAACTTCAATTTATATTTATCTAGAAATGAATGTTGGTCGCGCATTGGAGAGCGCACTGTAGTCCAGCTG
CCGCCATCAAAAGACAGCAACCTGCACGTCCAAGGCGGCGTCTCAAGCGGGTTCGGGTTGGTACTACTGCAGACTCGTGAGGGCTCTGTCAAGAAGCAAG
AGAATGCGCGCTTCATGGCGGATCTTTTCGTCGCTGCTCTCCGATCGGAGGAGTACGAGGAGCTGCAGCCAGCCAAGGTAGTGATCGTGACTGACAACGC
GCCTGCGCACAGCGAGGTGGAGAGGCTGGCGCGCGAGTACCTGGCCGCGGATGGCATCGTGAACCTGAACAAGTTCGTCGTCCTGCGCCTAGGCCCCTAC
AGTCCGATGCTGAACCCCATCGAGGGGTGCTGGAACTCGCTTAAAGCTAAAATGCGTCGGTTCATGGCCGAGAGAAAGGAAGAGTTTTTGGTGCGTGGTG
AATATGTCACGTTCACGGAGCACCGCATGCAGTTGATGAAGGAGGTAGTGGAGTTTGGCAAGACGGTGATTACTGCGCGACTTGTGTGA
	
	
WLASFAPSKKARTGMRWPLPTTSTTILLAEPSTLPARNPSSAAAYALLQSK_RWRS_ASSRS_STRIAA_HWSSYATVSTPTLASMSVWRQCIAHSRACF
TRRSACASRRRR_TQASTRRSARPLSQS_TSTSRRVTWWCFKRLTSIYIYLEMNVGRALESAL_SSCRHQKTATCTSKAASQAGSGWYYCRLVRALSRSK
RMRASWRIFSSLLSDRRSTRSCSQPR__S_LTTRLRTARWRGWRASTWPRMAS_T_TSSSSCA_APTVRC_TPSRGAGTRLKLKCVGSWPRERKSFWCVV
NMSRSRSTACS__RR_WSLARR_LLRDLC