Scaffold : Scaffold_1
Gene_id : Phyra_g33
Description : hypothetical protein
ATGGGTGAAGGAGCTGCGGCACACGCCGGTGGCGAGTTCCGCATCGTGCACCTCAACGATGCAACACGCAATACGGAAGCCGGCTATTGCAACAACTTCA
TCGTCACGTCCAAGTACACGGTGGCGAGCTTCCTGCCCAAGTTCCTCTTCGAGAGCTTCCGCAAACTCTCCAACCTCTACTTCCTCCTCATCTGTATCCT
GCAGTGCATCCCTGACATCAGTAACACCGGCGGCCAGCCTTCCACCTTACCCCCACTCCTCTTTATCATCACCGTCGATGGCGTGTTTGCTATCCTCGAA
GACCACAAGCGTCACCAAGCTGACAACGTTGCCAACGCGAGTCCGACACTCGTTCTAGACCGTGCATCGAAGAAGTTCACTCCAACTACGTGGGCCGATG
TCGTAGTAGGCGACGTTGTCAAGGTGGTGAATCGAGGACTGGTACCGGCAGATATGCTCGTGCTCGCCGTGAGTGAAATTCCTAATCAGCCTCCGTGTGG
AATTTGCTACGTCGAGACCAAGTCTTTGGATGGAGAGACCAACATGAAAGTCCGATCAGCAATGGAGTGTACTCTTGCAGATATGGGCTCAATTGATAAC
TTGGTCAAGATGAAAGGCACCATCCGCTGCGAACATCCGAACAATGCAATCAACAGTTTCCAGGGTGTGCTGGAGCTTGAAGGAAAGGAGAACGCTTCCA
TCCCGTACGAAAGTATCATCCTGCGTGGCTGTATCATCCGAAACACCGACTGGGTGCACGGTATGGTTTTCAACACCGGCAAGGACACGAAGATTATGAT
GAGCAACTCGGCGCCTCCGTCTAAGATGAGTTCCATGGACCGGTCGATCAACCGGTACACGGTTGTGTTGCTATCAATTTTGATTGTCTTCAGTGCTGTA
GGTGCAACAGGAGCGGTGGCCTGGAAGGCGAACAACGGTTCTGTGTGGTACTTGGAAATGAACGTGTCCGACAACAGCGCTTTTGTGGATTGGATTGTCA
TGCTATTCTACTATCTGCTACTCATGTACCAGTTCGTGCCAATTTCACTTGCTGTTTCCATGAGCATGGTCAAGTATCTCCAGGCGCAATTTATTCAGTG
GGACATCAAGATTTACCACCCCGAAACAGACACCCCGACATTAGTGCGCTCCATGTCGCTCAACGAAGAGCTCGGGCAGATTTCGTACATTTTCTCGGAC
AAAACGGGAACACTCACCTGCAACGTCATGGAGTTCCGGAAGTGCTCCATTGGCGGGGTCTCCTACGGAAACGGAACCACTGAGATCGGGCTAGCGGCAC
TAAGGCGTGCCGGCAAACCCCTTCCAGATATGACCGCACAGTCTACGGGGCCCAAGGTTCCTTACGTAAATTTCGATGGTCCCGAGCTGTTTAATGATAT
GAAGGGGGACTCAGGCTCCGTCCAACAGGGACGTATTGATGCCTTCTTCACGCATCTTGCAGTTTGTCACACCGTCATCCCAGAGCGGCACGAAAACTCC
AAAGAAATCACGCTGTCGGCTTCATCTCCTGATGAACAAGCACTCGTTGCGGGTGCAGGTTACTTTGGATATGAGTTCGTAAATCGATCTCCGGGTGTCG
CTCATGTCAAAGTTCGTGGAATAGTACAAAAGTACGAGATGCTGGACGTTCTCGAGTTCAACAGTACGCGAAAGCGTATGAGTACGATTATCCGTCACCC
AAATGGACGGATCTTCTTGTACTCCAAAGGTGCAGATGTTATCATCTACGGATTACTAGCGAAGGACAAGGAGGACGAATCTACTTCTTCCCAGCTCCAG
GAGATCACTCGGCGCCATATCGACCAATACGCTGAAGACGGACTGCGGACTCTGACGATTGCGGTTCGTGAAATTGAGCGTTCGTATTACGCCGAATGGG
CAACAAGGTTCCACGACGCGCAGAACAACCTAGCGGAAATCGACAAGCGAAAGAAGGACCTCCCAAACGCAATTGACCAATGTATGAACGAGATTGAGTG
CGACTTGGAGCTGCTTGGGGCCACTGCAATCGAGGACAAATTGCAATCTGGTGTTCCTGACGCAATCGCCAACTTGGCGTGTGCGGGCATTAAAATCTGG
GTACTCACTGGTGACAAGGAGGAGACGGCTATCAACATCGGCTTCGCTTGCCAGCTTATAACGAACGACATGAAGCTTTTTATCATCAACTCGAAAATCG
CAGCAACTCCCGAAGTACTTGAGAGCACGCTAAGAGATGAGATTGGAGCCCGCAGTGCAGATGTGACTGTCTACCTCGCTTCGCCTCCCAGTACGAGAGG
TGATCTCCGCGAGTTGGCCCTTGTCATTGATGGTGAGACGTTAATGTTTGCCCTTCGCGGGTCGTGCCGTCCTCTGCTCGCCGAGTTCTCGCAATACTGC
AAAGCTGTTATCGCTTGCCGTGTATCACCAGCCCAAAAAGCGGAGATGGTTGCTTTGATCAAGGAGTACGTACCTGGAGTTCGTACTCTTGCTATCGGAG
ACGGAGCGAACGATGTTTCAATGATCCAAGAAGCGCACGTCGGTGTGGGAATTTCAGGCCAAGAGGGCATGCAAGCTGTCAACTCCAGTGACTATGCTAT
CGCGCAATTTCGCTTTCTGCAGCGCCTGTTGCTTGTGCATGGTCGTTGGAATTACAGGCGAATGGCTCAGCTAGTGTTGTTCATATTCTACAAGAACATC
CTCTTCACTGCTGCTCAATATTGGTACACACTGTTATGCGGGTTCTCGGGACAGAAGTTTTTCTTGGAGAGCGGAACACAGCTGTACAATATCGCCCTGA
CGGCCATTCCGATCGTTGCCTCCTCCATTTTGGACCAAGATGTCAACGACGATGTAGCCATGACATTTCCGAAGCTCTATTTCACGGGACCTCGTGATGA
AGACATCAACACCAGCACCTTCTCCTTGTGGGTGGTTGGAGCGATCCTGGAGAGTATTATCATCACGTTTATCACAATTCACAGCATGAACAACGCGGGC
TTCTCTGGAGGCAGTCCGTCGATGTGGTTGGAGGGCTTTATCGTCTTTACCCTTGTCGTGACTATCGCCAACTCAAAGTTGTTCATGTTCCAGAACAGTT
TCTACTTCTTCAACTACTTTATCTACATGGGCTCAGTTTTGGTGTGGCTTCTGGTTGCATTGGTGTGCAGCCACGTTGCAATGCTCTCGGACCTCACATG
GGAGTTGATGCTGGAGCAAGCTTTTGGGCTTCCATCCTTCTGGCTGGTCTGTTTGTTCGTCCCCGTGGCAGCGCTCTCGTATGCACATCTACTCAACGGC
ATCAGGTCGACGTTCTTTCCAGAGTACTGGCACCTCGCCAAAGAGACCATCAAGTTCAACCTTGACCGCAAGCTCCTACAGTGGAACGACAATAGCAATG
CATCGGTTGCGGTGCCAGCCCGCCTTCCGCACGCAAATCGAGCCGCCAAGAAGAACGGTTCCGTCATACCGACAGATGGCCGGCCTTCACAGCACAGGAC
AACATTACAGAAGGCATATCACGGCTTCGCCTTCTCGAAAGATGGCTACGCTGGTGCCACCGAGACACGGTTGCTCATGAGTCGGAGCTCCATCACAAGT
GCAACATGAGTGCAAGACAGTTAGATCCTAGTCTCGATCCACATTAGTACATAGACATTACCCCTTCATCGGGAGTTCTATGTTGCCATCTCCCCTAAAT
GTTAGCATTGTCACTTACTGATGCGAGGGCTGGGGAGGAAGAGGCACCACATTGCCAGCATCGGCGTAGCCGATCCGAGACTGAAACTTCGAGTTATTCG
GTGAGAAGAACAGCAGCTCGTCGACAGCACGATGTCTTCCCTCAAACGTCGTGGGTGCATCAGCTCGAAAGGCAGCGGCTCGACGAAGGTATAATCTAAC
GTATCAGTCGCCTAGTGTTAGAATTCGCCACTGCGCCTTCATCTCCATGCCCAGTAGTGGTTTACCTGGCTGTCGCTGCTTCCAGTCTCATGCAACGTTT
CAGCCTCAATGTACGCCCCTCTCGACGCCAAGACAAACGAGATCGCTGTCGTTTAACCCGTCGGTATCTCTCCACAAAACGATCTCCGTCTGGCTCCGTC
GCAGCCACGAGTCGAAATGCGAGGCGATGAGGACTACAGCGACTCATCCGAGCGACGCCGCGCAGGTTCCTGCCCAGTCGCAGGCTCTTCACGGTTCCGG
ATATGTGCGCGTCGCGCTCCAGCTGCTCTTCCCGTCGAATTTCCTCCTGCCTCGCTGCCTCCAAGACTTCTTGTGACGCTGCCACATCTCTATCGTTCGT
CTTCTTGGCTGTAGCCGCATCAACTCGCTTCTTTTTGTTCGTGCGTCGCGCCACCAGCCGCTCGTACCTGTCAGGAGCGCACACAGCATCAGCACAACGA
TGCAAATGCTATAGCAATTCGGTAGCGGCGCATACAGGCGGTTGAAGTCGTCCTCGGCCATTTTGACTATGATATCCTTAAGTACGAAACAAACTTACAG
GCAGCCACAGGTTCATTAATCGACGTCAAGATGCTGCGCGTGTCCGGTCTACTGCGGGGCTTGACGGCGGCACCGCTACGTCCTCGCAGCATCCTCGGAG
GCTGCTCGACTCGCTGCTTCAGTGTGCAAAGCGGCGATGATGACGACGACGATGACGACGATGACGACGATGACGACGCGCTGGAGGAGCTGGACTGGGA
CGACCTGGACGAGGACTGGACGCTAGACGACGAGGGCGACGCGGCCTTGGCGGGGCGTCGCAAGGTCGAGGAGCACGTCAAGCAGAAGGTGCGCGTGCGA
CGCGCGCAGCACTCCAAGCGCCGCTTCGTGGACCGCATCCGCGTCAAGGCCACGGGCGGCCACGGAGGCAATGGCTGCGCCAGTTTCTTCGCCGAGTCGG
CCATGCGCAAGCGACCAAATGGCGGACACGGCGGTGCTGGAGGAGACGTCCTGATCGAAGCCTCCGACAAGATGCAGAACTTGGCGAACGCCACGCACCA
CTTTAGGGGAGGCGCCGGCACCAACGGCATGGGTACGTGCATGGGATTCATTTGTGTGCTGCAAATACTTTTTCAGGGTACTGACTCTTGCGTGGCTGGC
GTCCAGCAAATGATTCTGCTGGAAGGAGAGGCAAGCATTGCCACGTCAAGGTGCCGTGTGGTACACTCGTCAAGCGCGTGGAGCGCTACGAGCGCGAACT
GGAGAATGGCGAGTACGAGATTGTGGACCAGATGGAAGTGGTGTGTGATCTAGACGAGCCTGGAGCGACGTTCCTTGCTGCGAAGGGCGGAAAGCCTGGA
CTGGGTAACCGCATCCTGGCAGGCAAGACGACCAAATTCGGACGGCTGCGCAAGCACATGCCGGAGAACAAGACGACGGGTCACCCGGGTACCTCGCAAT
ACTACGAGCTGGAACTCAAGACCATCGCTGATGTGGGTCTTGTAGGCTACCCGAATGCGGGCAAGTCGACGCTGTTGAGCGTTCTCAGCCGTGCGACGCC
TGAGATTGCACCTTATCCTTTTACGACGCTTCACCCATACGTGGGAATTGTGGAGTTCCCAGACACGTTCCGCTTGAGTGTGGCTGACATCCCTGGACTT
ATTGACGGTGCACACCGCAATGTTGGTCTTGGTCACGATTTCTTGCGCCACATCGAGCGCACAAAGGTGTGTGTGTATCATTGATCTGTCTCCTCTACCT
GGGCGATGAGCTAACCATGGTGTGTGTGCGGTGTTTTTACAGATTTTAATGTATGTGCTTGACACGGCGGGCTCGGAGGGACGTGATCCCCTCGAGGACT
TCACTCATCTTCAAAGAGAGCTGGAGCTGTATGCTCCAGGAATCTCGTCGCGTCCGTCCCTGATAGTTGCCAACAAGATGGATGAGCAAGGTACGGGAGG
AACATTTACTGTGAGTGCTTAGCACCCTCACTCTGACGTTGTTCTGGCATCATGCAGGCGCGGAAGAAAACTTCAACAAGCTGCGCCAGACCACCGATCT
AGCTGTACTCCCTGTCAGGTATAACTGCGCCCGCCTTCATACTTCTCTACTTCTTCAACGGAAATCTAACCATGATTTGTCTTGTTTACACAGTGCGCTC
CACAAAGTCGACATTGATACGGTAGCACGCACACTCCGCTGGATGATCGAAAGCTACAGCAAGCTCACCAAATCATCATAGAACCAGTGTAAGCCGCGTC
AGCAACACGAAAGGATTTTGACCTTTCTAGCAATTATCGTTACTGGTTTGTGTTTGTTTATAGGTGCAGAGGGTGCCTTACTATTCACATTGCTGGGGTT
GAGGAGCAGGTCCAAGATGAACCGCTATGAAATGCTGGACCGAGTTGGTGACGGCGCTTTCGGGGAAGTGTCGCGTGCGCGTAGCGTCAAGACCCATGAA
ATAGTCGCTGTAAAGAAGATCAAGGCGTTGTTCCCCACGTGGGAGGAGTGTCTCCAGCTACGCGAATTGAAGTCGCTGCGCGTGCTTCGCCATGAAAACA
TCGTGCTTCTAAAAGAGGTCATTCGAGACAAGGAGGAGCTCTACTTCGTGTTCGAGTACATGCAGACGTCACTTTTTCGGGTCATGCGCAACTTCAAAAC
TCTCGGAAGCTCCAGCTCAAGTGGTGCTGGAGGCGATCCAAGCTTAAATTCTGATGCTACCAGTTCATCTCGATCTTCGGTGCCCCCGCATCCATGGTTC
TCAGAGGCACAGATCCGTTCGATGATGTACCAGCTCTTCAGTGGCCTAGCATACATGCACAAGCACGGATTCTTCCATCGCGACATCAAGCCTGAGAACC
TGTTGTGTCACAATGATACACTCAAGATCGCTGACTTGGGCCAAGCACGCGAAATTCGATCGCGACCGCCGTTTACAGACTACGTGGCTACGCGATGGTA
CCGCGCGCCAGAGCTCTTACTGCGCTCAACAACGTACAACAGCCCCGTTGATATGTGGGCCTGCGGATGCATCATGGTCGAGCTGCTGGTTTGTACGCCG
CTCTTCCCAGGGACGTCAGAGGCTGACCAGTTCTACCGCATCTGCAAGGTTTTAGGAACACCGACCAAGGAGACGTGGCCTGAAGGTGCAGCGATGTCTT
CTCATATGCAGATGCGTTTCCCCAAGTGCTCTCCTGTGTCCTGGACTCGATTTCTACCGCCCGGCACACCATCCACAGCGGTTCAACTTGTCCAAGACCT
ACTGCAATTTGACCCGAGTCGACGTCTCACAGCGGCGCAAGCCCTTCAACACCGCTTTTTCGACCAGCCATTGGCACGGCCAACGCTTGCGGTGCCTACT
TTAGTGCTGCACGAGGAAGAAGTGCCCGTGTTGCCGCTACGGAGCGACCACAAAACTATAGGAGGCTACTCTAGCTATGCTGGAAGGACAAGTGTGTGCT
CGAAAAAGTCGGAGGAAATTCCGGTATCTGCTGTGGAGCCTGCTAGTCATTGGGCTGGTGGCGGTGCCATGTCATCGCGACGAGAGTGGACAGCCAAAGA
GCGATACCAAGCACACGCACGGCACCAAGAATGGGGCTCTTCGCTTGTCAGTGCTCGTGGCGAGAT
	
	
ATGGGTGAAGGAGCTGCGGCACACGCCGGTGGCGAGTTCCGCATCGTGCACCTCAACGATGCAACACGCAATACGGAAGCCGGCTATTGCAACAACTTCA
TCGTCACGTCCAAGTACACGGTGGCGAGCTTCCTGCCCAAGTTCCTCTTCGAGAGCTTCCGCAAACTCTCCAACCTCTACTTCCTCCTCATCTGTATCCT
GCAGTGCATCCCTGACATCAGTAACACCGGCGGCCAGCCTTCCACCTTACCCCCACTCCTCTTTATCATCACCGTCGATGGCGTGTTTGCTATCCTCGAA
GACCACAAGCGTCACCAAGCTGACAACGTTGCCAACGCGAGTCCGACACTCGTTCTAGACCGTGCATCGAAGAAGTTCACTCCAACTACGTGGGCCGATG
TCGTAGTAGGCGACGTTGTCAAGGTGGTGAATCGAGGACTGGTACCGGCAGATATGCTCGTGCTCGCCGTGAGTGAAATTCCTAATCAGCCTCCGTGTGG
AATTTGCTACGTCGAGACCAAGTCTTTGGATGGAGAGACCAACATGAAAGTCCGATCAGCAATGGAGTGTACTCTTGCAGATATGGGCTCAATTGATAAC
TTGGTCAAGATGAAAGGCACCATCCGCTGCGAACATCCGAACAATGCAATCAACAGTTTCCAGGGTGTGCTGGAGCTTGAAGGAAAGGAGAACGCTTCCA
TCCCGTACGAAAGTATCATCCTGCGTGGCTGTATCATCCGAAACACCGACTGGGTGCACGGTATGGTTTTCAACACCGGCAAGGACACGAAGATTATGAT
GAGCAACTCGGCGCCTCCGTCTAAGATGAGTTCCATGGACCGGTCGATCAACCGGTACACGGTTGTGTTGCTATCAATTTTGATTGTCTTCAGTGCTGTA
GGTGCAACAGGAGCGGTGGCCTGGAAGGCGAACAACGGTTCTGTGTGGTACTTGGAAATGAACGTGTCCGACAACAGCGCTTTTGTGGATTGGATTGTCA
TGCTATTCTACTATCTGCTACTCATGTACCAGTTCGTGCCAATTTCACTTGCTGTTTCCATGAGCATGGTCAAGTATCTCCAGGCGCAATTTATTCAGTG
GGACATCAAGATTTACCACCCCGAAACAGACACCCCGACATTAGTGCGCTCCATGTCGCTCAACGAAGAGCTCGGGCAGATTTCGTACATTTTCTCGGAC
AAAACGGGAACACTCACCTGCAACGTCATGGAGTTCCGGAAGTGCTCCATTGGCGGGGTCTCCTACGGAAACGGAACCACTGAGATCGGGCTAGCGGCAC
TAAGGCGTGCCGGCAAACCCCTTCCAGATATGACCGCACAGTCTACGGGGCCCAAGGTTCCTTACGTAAATTTCGATGGTCCCGAGCTGTTTAATGATAT
GAAGGGGGACTCAGGCTCCGTCCAACAGGGACGTATTGATGCCTTCTTCACGCATCTTGCAGTTTGTCACACCGTCATCCCAGAGCGGCACGAAAACTCC
AAAGAAATCACGCTGTCGGCTTCATCTCCTGATGAACAAGCACTCGTTGCGGGTGCAGGTTACTTTGGATATGAGTTCGTAAATCGATCTCCGGGTGTCG
CTCATGTCAAAGTTCGTGGAATAGTACAAAAGTACGAGATGCTGGACGTTCTCGAGTTCAACAGTACGCGAAAGCGTATGAGTACGATTATCCGTCACCC
AAATGGACGGATCTTCTTGTACTCCAAAGGTGCAGATGTTATCATCTACGGATTACTAGCGAAGGACAAGGAGGACGAATCTACTTCTTCCCAGCTCCAG
GAGATCACTCGGCGCCATATCGACCAATACGCTGAAGACGGACTGCGGACTCTGACGATTGCGGTTCGTGAAATTGAGCGTTCGTATTACGCCGAATGGG
CAACAAGGTTCCACGACGCGCAGAACAACCTAGCGGAAATCGACAAGCGAAAGAAGGACCTCCCAAACGCAATTGACCAATGTATGAACGAGATTGAGTG
CGACTTGGAGCTGCTTGGGGCCACTGCAATCGAGGACAAATTGCAATCTGGTGTTCCTGACGCAATCGCCAACTTGGCGTGTGCGGGCATTAAAATCTGG
GTACTCACTGGTGACAAGGAGGAGACGGCTATCAACATCGGCTTCGCTTGCCAGCTTATAACGAACGACATGAAGCTTTTTATCATCAACTCGAAAATCG
CAGCAACTCCCGAAGTACTTGAGAGCACGCTAAGAGATGAGATTGGAGCCCGCAGTGCAGATGTGACTGTCTACCTCGCTTCGCCTCCCAGTACGAGAGG
TGATCTCCGCGAGTTGGCCCTTGTCATTGATGGTGAGACGTTAATGTTTGCCCTTCGCGGGTCGTGCCGTCCTCTGCTCGCCGAGTTCTCGCAATACTGC
AAAGCTGTTATCGCTTGCCGTGTATCACCAGCCCAAAAAGCGGAGATGGTTGCTTTGATCAAGGAGTACGTACCTGGAGTTCGTACTCTTGCTATCGGAG
ACGGAGCGAACGATGTTTCAATGATCCAAGAAGCGCACGTCGGTGTGGGAATTTCAGGCCAAGAGGGCATGCAAGCTGTCAACTCCAGTGACTATGCTAT
CGCGCAATTTCGCTTTCTGCAGCGCCTGTTGCTTGTGCATGGTCGTTGGAATTACAGGCGAATGGCTCAGCTAGTGTTGTTCATATTCTACAAGAACATC
CTCTTCACTGCTGCTCAATATTGGTACACACTGTTATGCGGGTTCTCGGGACAGAAGTTTTTCTTGGAGAGCGGAACACAGCTGTACAATATCGCCCTGA
CGGCCATTCCGATCGTTGCCTCCTCCATTTTGGACCAAGATGTCAACGACGATGTAGCCATGACATTTCCGAAGCTCTATTTCACGGGACCTCGTGATGA
AGACATCAACACCAGCACCTTCTCCTTGTGGGTGGTTGGAGCGATCCTGGAGAGTATTATCATCACGTTTATCACAATTCACAGCATGAACAACGCGGGC
TTCTCTGGAGGCAGTCCGTCGATGTGGTTGGAGGGCTTTATCGTCTTTACCCTTGTCGTGACTATCGCCAACTCAAAGTTGTTCATGTTCCAGAACAGTT
TCTACTTCTTCAACTACTTTATCTACATGGGCTCAGTTTTGGTGTGGCTTCTGGTTGCATTGGTGTGCAGCCACGTTGCAATGCTCTCGGACCTCACATG
GGAGTTGATGCTGGAGCAAGCTTTTGGGCTTCCATCCTTCTGGCTGGTCTGTTTGTTCGTCCCCGTGGCAGCGCTCTCGTATGCACATCTACTCAACGGC
ATCAGGTCGACGTTCTTTCCAGAGTACTGGCACCTCGCCAAAGAGACCATCAAGTTCAACCTTGACCGCAAGCTCCTACAGTGGAACGACAATAGCAATG
CATCGGTTGCGGTGCCAGCCCGCCTTCCGCACGCAAATCGAGCCGCCAAGAAGAACGGTTCCGCAGCCACAGGTTCATTAATCGACGTCAAGATGCTGCG
CGTGTCCGGTCTACTGCGGGGCTTGACGGCGGCACCGCTACGTCCTCGCAGCATCCTCGGAGGCTGCTCGACTCGCTGCTTCAGTGTGCAAAGCGGCGAT
GATGACGACGACGATGACGACGATGACGACGATGACGACGCGCTGGAGGAGCTGGACTGGGACGACCTGGACGAGGACTGGACGCTAGACGACGAGGGCG
ACGCGGCCTTGGCGGGGCGTCGCAAGGTCGAGGAGCACGTCAAGCAGAAGGTGCGCGTGCGACGCGCGCAGCACTCCAAGCGCCGCTTCGTGGACCGCAT
CCGCGTCAAGGCCACGGGCGGCCACGGAGGCAATGGCTGCGCCAGTTTCTTCGCCGAGTCGGCCATGCGCAAGCGACCAAATGGCGGACACGGCGGTGCT
GGAGGAGACGTCCTGATCGAAGCCTCCGACAAGATGCAGAACTTGGCGAACGCCACGCACCACTTTAGGGGAGGCGCCGGCACCAACGGCATGGCAAATG
ATTCTGCTGGAAGGAGAGGCAAGCATTGCCACGTCAAGGTGCCGTGTGGTACACTCGTCAAGCGCGTGGAGCGCTACGAGCGCGAACTGGAGAATGGCGA
GTACGAGATTGTGGACCAGATGGAAGTGGTGTGTGATCTAGACGAGCCTGGAGCGACGTTCCTTGCTGCGAAGGGCGGAAAGCCTGGACTGGGTAACCGC
ATCCTGGCAGGCAAGACGACCAAATTCGGACGGCTGCGCAAGCACATGCCGGAGAACAAGACGACGGGTCACCCGGGTACCTCGCAATACTACGAGCTGG
AACTCAAGACCATCGCTGATGTGGGTCTTGTAGGCTACCCGAATGCGGGCAAGTCGACGCTGTTGAGCGTTCTCAGCCGTGCGACGCCTGAGATTGCACC
TTATCCTTTTACGACGCTTCACCCATACGTGGGAATTGTGGAGTTCCCAGACACGTTCCGCTTGAGTGTGGCTGACATCCCTGGACTTATTGACGGTGCA
CACCGCAATGTTGGTCTTGGTCACGATTTCTTGCGCCACATCGAGCGCACAAAGATTTTAATGTATGTGCTTGACACGGCGGGCTCGGAGGGACGTGATC
CCCTCGAGGACTTCACTCATCTTCAAAGAGAGCTGGAGCTGTATGCTCCAGGAATCTCGTCGCGTCCGTCCCTGATAGTTGCCAACAAGATGGATGAGCA
AGGCGCGGAAGAAAACTTCAACAAGCTGCGCCAGACCACCGATCTAGCTGTACTCCCTGTCAGCAGGTCCAAGATGAACCGCTATGAAATGCTGGACCGA
GTTGGTGACGGCGCTTTCGGGGAAGTGTCGCGTGCGCGTAGCGTCAAGACCCATGAAATAGTCGCTGTAAAGAAGATCAAGGCGTTGTTCCCCACGTGGG
AGGAGTGTCTCCAGCTACGCGAATTGAAGTCGCTGCGCGTGCTTCGCCATGAAAACATCGTGCTTCTAAAAGAGGTCATTCGAGACAAGGAGGAGCTCTA
CTTCGTGTTCGAGTACATGCAGACGTCACTTTTTCGGGTCATGCGCAACTTCAAAACTCTCGGAAGCTCCAGCTCAAGTGGTGCTGGAGGCGATCCAAGC
TTAAATTCTGATGCTACCAGTTCATCTCGATCTTCGGTGCCCCCGCATCCATGGTTCTCAGAGGCACAGATCCGTTCGATGATGTACCAGCTCTTCAGTG
GCCTAGCATACATGCACAAGCACGGATTCTTCCATCGCGACATCAAGCCTGAGAACCTGTTGTGTCACAATGATACACTCAAGATCGCTGACTTGGGCCA
AGCACGCGAAATTCGATCGCGACCGCCGTTTACAGACTACGTGGCTACGCGATGGTACCGCGCGCCAGAGCTCTTACTGCGCTCAACAACGTACAACAGC
CCCGTTGATATGTGGGCCTGCGGATGCATCATGGTCGAGCTGCTGGTTTGTACGCCGCTCTTCCCAGGGACGTCAGAGGCTGACCAGTTCTACCGCATCT
GCAAGGTTTTAGGAACACCGACCAAGGAGACGTGGCCTGAAGGTGCAGCGATGTCTTCTCATATGCAGATGCGTTTCCCCAACCTGCTAGTCATTGGGCT
GGTGGCGGTGCCATGTCATCGCGACGAGAGTGGACAGCCAAAGAGCGATACCAAGCACACGCACGGCACCAAGAATGGGGCTCTTCGCTTGTCAGTGCTC
GTGGCGAGATA
	
	
MGEGAAAHAGGEFRIVHLNDATRNTEAGYCNNFIVTSKYTVASFLPKFLFESFRKLSNLYFLLICILQCIPDISNTGGQPSTLPPLLFIITVDGVFAILE
DHKRHQADNVANASPTLVLDRASKKFTPTTWADVVVGDVVKVVNRGLVPADMLVLAVSEIPNQPPCGICYVETKSLDGETNMKVRSAMECTLADMGSIDN
LVKMKGTIRCEHPNNAINSFQGVLELEGKENASIPYESIILRGCIIRNTDWVHGMVFNTGKDTKIMMSNSAPPSKMSSMDRSINRYTVVLLSILIVFSAV
GATGAVAWKANNGSVWYLEMNVSDNSAFVDWIVMLFYYLLLMYQFVPISLAVSMSMVKYLQAQFIQWDIKIYHPETDTPTLVRSMSLNEELGQISYIFSD
KTGTLTCNVMEFRKCSIGGVSYGNGTTEIGLAALRRAGKPLPDMTAQSTGPKVPYVNFDGPELFNDMKGDSGSVQQGRIDAFFTHLAVCHTVIPERHENS
KEITLSASSPDEQALVAGAGYFGYEFVNRSPGVAHVKVRGIVQKYEMLDVLEFNSTRKRMSTIIRHPNGRIFLYSKGADVIIYGLLAKDKEDESTSSQLQ
EITRRHIDQYAEDGLRTLTIAVREIERSYYAEWATRFHDAQNNLAEIDKRKKDLPNAIDQCMNEIECDLELLGATAIEDKLQSGVPDAIANLACAGIKIW
VLTGDKEETAINIGFACQLITNDMKLFIINSKIAATPEVLESTLRDEIGARSADVTVYLASPPSTRGDLRELALVIDGETLMFALRGSCRPLLAEFSQYC
KAVIACRVSPAQKAEMVALIKEYVPGVRTLAIGDGANDVSMIQEAHVGVGISGQEGMQAVNSSDYAIAQFRFLQRLLLVHGRWNYRRMAQLVLFIFYKNI
LFTAAQYWYTLLCGFSGQKFFLESGTQLYNIALTAIPIVASSILDQDVNDDVAMTFPKLYFTGPRDEDINTSTFSLWVVGAILESIIITFITIHSMNNAG
FSGGSPSMWLEGFIVFTLVVTIANSKLFMFQNSFYFFNYFIYMGSVLVWLLVALVCSHVAMLSDLTWELMLEQAFGLPSFWLVCLFVPVAALSYAHLLNG
IRSTFFPEYWHLAKETIKFNLDRKLLQWNDNSNASVAVPARLPHANRAAKKNGSAATGSLIDVKMLRVSGLLRGLTAAPLRPRSILGGCSTRCFSVQSGD
DDDDDDDDDDDDDALEELDWDDLDEDWTLDDEGDAALAGRRKVEEHVKQKVRVRRAQHSKRRFVDRIRVKATGGHGGNGCASFFAESAMRKRPNGGHGGA
GGDVLIEASDKMQNLANATHHFRGGAGTNGMANDSAGRRGKHCHVKVPCGTLVKRVERYERELENGEYEIVDQMEVVCDLDEPGATFLAAKGGKPGLGNR
ILAGKTTKFGRLRKHMPENKTTGHPGTSQYYELELKTIADVGLVGYPNAGKSTLLSVLSRATPEIAPYPFTTLHPYVGIVEFPDTFRLSVADIPGLIDGA
HRNVGLGHDFLRHIERTKILMYVLDTAGSEGRDPLEDFTHLQRELELYAPGISSRPSLIVANKMDEQGAEENFNKLRQTTDLAVLPVSRSKMNRYEMLDR
VGDGAFGEVSRARSVKTHEIVAVKKIKALFPTWEECLQLRELKSLRVLRHENIVLLKEVIRDKEELYFVFEYMQTSLFRVMRNFKTLGSSSSSGAGGDPS
LNSDATSSSRSSVPPHPWFSEAQIRSMMYQLFSGLAYMHKHGFFHRDIKPENLLCHNDTLKIADLGQAREIRSRPPFTDYVATRWYRAPELLLRSTTYNS
PVDMWACGCIMVELLVCTPLFPGTSEADQFYRICKVLGTPTKETWPEGAAMSSHMQMRFPNLLVIGLVAVPCHRDESGQPKSDTKHTHGTKNGALRLSVL
VAR