Scaffold : Scaffold_1
Gene_id : Phyra_g10
Description : hypothetical protein
TGGAGGAAGTACAGGACTACAGCGATATTATATATGCTCATGCCGTGCTGCTGGCCGTGGTGCTCGTGCCGACGCTCGTTCGTGTGCGAATCGTGTACAC
ATTCCTGTGGAACCTGTTCACCGTCATCGCCATCAAGATGGAGTCTCGTACGGCGCAGGGACTCGCTACGGTCATGGGGTTGTCGGTGATGCTGTCGTGG
TATATGCTGCGCTACTTCGACCGCTCCGTGTTCGACAGCGTGCTGCTCGGCTGGTTCGGCCTCCTGAGCAAGTACCGCGTCTTCCGCGGACTCGCGAACA
CTGGCGATTTCCTGCTGCACTTTGTGTGTCCGCTGGCGCTCGCTGCCAAGTACCTGGAGCACGTCGAAGTGTGGATGGCGCTGCCGGTCCTGGGGTACGT
AGATGCGAGGGTTGAGCTAGTGCGCAACCGACTAACGTGCAGGTGTGTCCGGTGTGATCTGCAGCTTCTCGGTGCTGTGGGTGTACTTCGTCGCGGGCGG
CTCGCTGGTTGCGAACCACGTGTATCACTTCTCGCCGCCGCGCCCGGTGCAGTTCTGGGCCGTGGCCAGTGCCTCCATGCTCGTGGGCAACCTCACGGTG
CCGCTGGGCTGCGTTCTTGCACAGCGCAGCGGTCTGCCTGACCTGTTGGTCCGCGGCGTGGAAGAGTTGGCCGCACCGCTAAGGCAGAGCTCGTTTGCAG
TCTGAAATGTCACGTTTCCAAAACCATATAAAAAGGCGCTTCAATATATTGTATTTCACAGGTGTACAACTGATAAGAGATCTGTTTGTATGGAAATTAA
TACAACATCTCTCCTTGTACTATATGCATTTAAGCAGGCTATAGGTTTTTCAAATCTAGCGTCATCAATGTCCCACTCCTGGTCTCACCACTCGCGACTC
GTGAGAAGCGGATGGAGCTTTTCAGTTTCTGGTCGTCCTCGGACGCCGGAGCAGGTCCTGGCCGATGGACGCCGCCCAGTTCTTCGCCGTGGCGCACGAT
ACACTGACGCACACGGTGCTCAAGGTGCGCGATGGCGAGCAGCGGTTGGGTGCAGTTGCTGCTGAGGGCTCGGTGCCGCCGCTGAGCACAGACGCCATGC
AAGCGGTGGTGCTGCTGTTCGCTATGGCGCTGCTGCCGGTGCTGGTGCGCGTCCGGATCCTCTACACGTTCTGCTGGGTGGCCTTCACGGTGCTGGCTCA
CGTGACCGGGTCGGAGGCGGCACTGGGCATTGCCACGTCGCTGGGGCTCACCATAATGATGGGCTGGTACTCGCTGCGCATGCTTGACCGCTCCACGTTC
ATGGGCATCCTGCAGGGCTGGTTCGGCTTCCTGAGCAAGTACCGGCCCTTCCGGCTGCTGGCCAACTCCGTCGACATCCTGCTGCACATGGGCGTGCCAC
TCACGCTCGCATTCTGCTACCTGCCGTTCGTACGGCTGTGGATGACAATCCCTATCTTGCTGTATGTGGGCGGGCATGAGGAGAGCACACGAATACTAAG
TTACTGACTGTGTGTGTGTGTTGAGCAGCTTCTCGCAGCTCTGGATCAAGCTGGTTGCTGGCGGGGACCTCTCCTTGAGAGGCAACGACGTCTACCACAT
CTACCCACCGCGCCCCAAGACATTCTGGCTGGCGGCTCGCAAGATCGAACTGGTCTACAATTTCACCATTCCCAGTATCTGTGTGCTCGCGTATCAAGTC
GGTATCCACGAATTCGTCGTTGACTGCTTCTTGAAACTCAGCTCATAGAAACAGGTAGCCTGCTGGACAGCCAATTAAACCTTGTAACAAAGCTCCATTG
TGTTTTCACTCATCGATGCAACATCGATCTCTACACATGTAGTAAAGCAAACGTGATCGCAGCACAATGACGACAACCATCTCGCTCTCAAGCTGGTGCG
ATCCGTGGTCCAGGCAAGTACATCATAATCGATATCCTGAAACCCATACTATATCGAAGTATATCTTACGATACCGGTATCAAAAGCAAACTCACTTCGC
AACTTTCGACCTAGCGCTCAAGATGATGGAGACGCTGCTGAACTGGGGAGTGCTGAGCCGTGGCAACCGCGACGCCGCCCAGTCCGACGACCAAGTGGAC
GCGGCGTTGGCCGTAGCGCTGCTGTTCAGCCTCGTGGTACTGCCTCCGCTCGTGGGTATCCGCACCATGTACACCAACTGCTGGTTCGCCTTCACCGTCG
TCGCGCACCTGCTGGCGTCCGAGGCCGCGCTGGGTATCGCCACATCCATGGGCATCACCATCATGGTCGGTTGGTACTCGCTGCGCGTGTTTGACCGATA
CGCCTTCACGGCCATCCTCAACGGCTGGCTCGGGGTCTGGGCTAGCTCGCCGGTGCTCGGGCTCGCTGCTCGCATAGGAGACTTCATGCTGCATCTGGTG
GTCCCTATGCTGCTGGTTTCGTGCTACTTGCCGTTTGTTCGTGTGTGGATGAGCGTGCCGGCTTTAATGTACGATACTGGAGTTAGGTGGTAGCTGAGTG
TGGAGCTCAATTTTCTAACTGTTGTTTGTGTGTGGGGGCAGATCGTCGCGACTGTGGAGCCACTTCGTGGTTGGCGGTGGCGTGTTCCCCAAGGCAGACC
ACATCTATCGCTTCTCGCCGCCGAGGTCGCAGCACTTTTGGAACGCTGCGTACAAGATGGAGCTCATGTTGAACCTGCTGGTCCCGCTCTTCTGCGTCCT
GGCACACCAGGTAGTACATTGAAACGCGCTGCAACTAGGCGCCATTGTCTCGCCTAAAGCCTTTTTTAATATCATGTTTGTCCTCGCTGGGCGGTGATGC
TGGTGCGTGACAGAGATCTTTCTGGGTGTACGCCGCGACGGCTATCGCGGGGGCAGTTCTGTTCTGCCTCCAGCTGATCCGGTCGCTTTCTCTGCCTAAA
CTGCGGCGAAATGCAAAGTCGATCATGTGCCGCTTGTTGTCCAGCGGCGGTATCCGACCGAATCTGGTACGCTTTCGCTATCGCTATCGACTCGAGGTGA
GCTGAGCTGAGCTGAATTAATCAAACCTCGTATTGCTCGCTCTCGCTCAGGACTTTGTCGTCCGGGATGACTCGTTTTGGCTGGATTGGATGAGTGAGGG
GCTCGTGGCTATCGGCGAGTCATACGTAGGGTGTTTGTGGACGACGAACTCCGCTCGAACCCTAGATGAGGTGGTTGCCGGCTTACTTACCATTCCTATG
GAGGGCAGACAAGAGATGTATCGGTCTTGGAGCGCTCGCTTTGTGGCATTGGCAGCACGGTTGTTCAGCTACCCACCATCGTCCATGGGTCTCGTTGTTG
GCGCTGTCTCGGAGCAGTTTGATCTCTGTCCGGAGTTTCGACAGGCGTACATGGACGGATACTTCCACCAAGGCTTCGGCATTTGGACTGCAGGGACTTT
GTCGATCAATGTTGCGCAGGCTAACAAGCTTGCAAACTTGGATCAGCTGCTCGACATTCGGGTGGGTGCATGCACATATTTGCCTTGAAGCAGTGACAGC
GTCTTAACTTTGTTGTCTATCGTGTGTGTGTTTCAGACTGGTCATACTGTCCTAGATATTAGTGTCGGCTCGTGGGGAGGAGTGGGCTGTTACCTCGCCC
AACAGCACCCCGACGCCACTGTTGTATGCATACTCTCCTCTGTCCAAGAGTTTGCACGTGCCAAGAAGTTCGCTCGTGATCTCGACGTTCTCGACCAAAT
GGAGTTTGTACTTGCTGAGACTCCGGATAATTTACTGACAATTCTGAGCGGCTTCCGTGCGTCCAAGTTCGACCGCATCACGCTGTGCGGTGTGGCGGAG
ACTGTGCCTGATCTGCAGAAGACGCGATTCCTACGCACACTCAAGCGTACCCAGACTACAAACGGCACCACGCTCCTGGAATTCAGCGCATGTACGGCCG
CACACATGACGACCCACGCCTGGACCAACAAATACGTGCACAGTGCGTACCCTTGCTACGCTATCACGCTGCCACTCATGCGTCGACTAGTCGGGGAGAC
GGGCTTCACGCTTCGAGACACAGTTGGGTACTCGGATCACTACGAGCGCACATTCCTCGAGTGGAACCGTCGATTCCAAGTACAGTGGGGACATGACTCA
ACACCAAGTGCAGTTGACCAGACTGCACCAGCGGACCAAACGACCGAGCTACCGCGCGTGCAATCGCTCCCCGAGTCCTTCAAGCGCACGTGGGAGTTCT
ACCTGTTGCATTCCGCTGCCTGTTACCGGTCTGGTGCACTCCAAGTGTTCCAGATCCGAATGGGGTGAGGCTGGAGAAACGCTGCTGTGCAGTTACGAGA
ATATTAGTGAAAGTTTTCAATTGCAATGAAATTCATCGAGGACACGGAAGATGTAGCGTTTGTCCTGCCTGCAACTCCAGGTTTCCTGGGGGGTGCACCC
GGCAAGGAGAGTGCACAGGAATGGGCTCCTTACCCAAATTCTCTGCACAGGAATGGGTCTCAAGTCTGACTTTGTAAAAAACTGTTTAAACTGTCTAAAT
CGTAAAACCAAAATTGTTTATGCCGAGAAAACCTGTTTTAGGCACTTGGACGCCATGGATGGCGAGTGGGAAAGGCACGCGGACGAGGCCTCCGGTTCGG
CGTACTACTACAACGTGCGCACGGGCGAGTCGTCGTGGGAGGTGCCTGCGGGTTTCAAGTCGCCGCGGGCGCAAGAATCGATCGAGAAGGAGGCCCCCAA
GTGGCGCGAGTTCGTGGACGACGAGTCCGGGGCCACGTACTACTACGACGAAGTGAGCGGCACTAGTCGCTGGGAGAAACCGGAGGGGTTTGCACTGGAG
AAGAAGAATACGCAGCAACAAGAAGTAGAAGAGCAGGAGATAGGGCAACCGCAAGAGGAGACGGTGGAGACGACACCGGAACATGCCGTGGGAGTGAAGA
AACAGGAGGTGGAAACGCTGGAGAAAGAAGGAGAAGAGACTGCATCTGCTTCTGCCCAGCAGTGGGTCAAATATGTGGACGCGAACAGCAACAAGCCGTA
CTTTTACAATGCCAGCACGGGCAAGACGCAGTGGGAGGAGCCCGAGGGCTTCGACGAGTCTACAGCAGCTACGCCGGCAGGTGCCCAGGTGTCCGCCGAG
TATCAGGCCCATCTTAACCGGATGCGCACGGAGCGCCTGGCACGAGTGACCCAGCAAGTGTTGGACCCGTCGGGTAACCTCAGTAAACTCAACGCCATTT
TGAACAAAGTTGACAGTAGCGCGTCGCCTGTTCCGGTTACAGCGGACGGGGAGGAGGCTGCAAACACCCCACGGACAGCAAAAGCGGAATGGCAGCAGCA
TATCGACGCGCAGACGCAGCGATACTACTACCACAATGTGGTAACGGGAGTTACGCAGTGGAACAAGCCGGATGCGCCTATTGTGTCAGGGGTACGTTTG
TGGAGCGCGCCATTTTGCATGACCCATTTCCTGTATTCTCACGCGTCTCGTGCTTGTTGTTGTTGCTATAATTTTGTTGTGCAGCTGGCCAATTGGATCC
CGCCCGAGGTCCCGGAATCGGATGAGTCTCGTGCAGGACAGAAAACTGTATCGGGCGTGAACTACGTTGCACGTGCCAAGTTTAACCGACTTACAGGAAA
GTACGAGCAGCTCGGCGGCGAGGACTATTGGCAACACGCTGGAATTGCTCCGGATCGAGCTGGGCGACAAATGAGCCATTTCTTTGATATGACTGAGCTC
GAGAAGAACCGCGAGGAAGCGCAGCGCAGAAAGGAGCAGCTAAAGCGCAAAAATATTGACTGGAAGAAAATAACAGCAGAGAAGAAGGCCAAGAAACAGA
AGCAGAAGAACGAGTGGCTCTACACCGATTA
	
	
TGGAGGAAGTACAGGACTACAGCGATATTATATATGCTCATGCCGTGCTGCTGGCCGTGGTGCTCGTGCCGACGCTCGTTCGTGTGCGAATCGTGTACAC
ATTCCTGTGGAACCTGTTCACCGTCATCGCCATCAAGATGGAGTCTCGTACGGCGCAGGGACTCGCTACGGTCATGGGGTTGTCGGTGATGCTGTCGTGG
TATATGCTGCGCTACTTCGACCGCTCCGTGTTCGACAGCGTGCTGCTCGGCTGGTTCGGCCTCCTGAGCAAGTACCGCGTCTTCCGCGGACTCGCGAACA
CTGGCGATTTCCTGCTGCACTTTGTGTGTCCGCTGGCGCTCGCTGCCAAGTACCTGGAGCACGTCGAAGTGTGGATGGCGCTGCCGGTCCTGGGCTTCTC
GGTGCTGTGGGTGTACTTCGTCGCGGGCGGCTCGCTGGTTGCGAACCACGTGTATCACTTCTCGCCGCCGCGCCCGGTGCAGTTCTGGGCCGTGGCCAGT
GCCTCCATGCTCGTGGGCAACCTCACGGTGCCGCTGGGCTGCGTTCTTGCACAGCGCAGCGGTCTGCCTGACCTGTTGGTCCGCGGCGTGGAAGAGTCCT
GGCCGATGGACGCCGCCCAGTTCTTCGCCGTGGCGCACGATACACTGACGCACACGGTGCTCAAGGTGCGCGATGGCGAGCAGCGGTTGGGTGCAGTTGC
TGCTGAGGGCTCGGTGCCGCCGCTGAGCACAGACGCCATGCAAGCGGTGGTGCTGCTGTTCGCTATGGCGCTGCTGCCGGTGCTGGTGCGCGTCCGGATC
CTCTACACGTTCTGCTGGGTGGCCTTCACGGTGCTGGCTCACGTGACCGGGTCGGAGGCGGCACTGGGCATTGCCACGTCGCTGGGGCTCACCATAATGA
TGGGCTGGTACTCGCTGCGCATGCTTGACCGCTCCACGTTCATGGGCATCCTGCAGGGCTGGTTCGGCTTCCTGAGCAAGTACCGGCCCTTCCGGCTGCT
GGCCAACTCCGTCGACATCCTGCTGCACATGGGCGTGCCACTCACGCTCGCATTCTGCTACCTGCCGTTCGTACGGCTGTGGATGACAATCCCTATCTTG
CTCTTCTCGCAGCTCTGGATCAAGCTGGTTGCTGGCGGGGACCTCTCCTTGAGAGGCAACGACGTCTACCACATCTACCCACCGCGCCCCAAGACATTCT
GGCTGGCGGCTCGCAAGATCGAACTGGTCTACAATTTCACCATTCCCACGCTCAAGATGATGGAGACGCTGCTGAACTGGGGAGTGCTGAGCCGTGGCAA
CCGCGACGCCGCCCAGTCCGACGACCAAGTGGACGCGGCGTTGGCCGTAGCGCTGCTGTTCAGCCTCGTGGTACTGCCTCCGCTCGTGGGTATCCGCACC
ATGTACACCAACTGCTGGTTCGCCTTCACCGTCGTCGCGCACCTGCTGGCGTCCGAGGCCGCGCTGGGTATCGCCACATCCATGGGCATCACCATCATGG
TCGGTTGGTACTCGCTGCGCGTGTTTGACCGATACGCCTTCACGGCCATCCTCAACGGCTGGCTCGGGGTCTGGGCTAGCTCGCCGGTGCTCGGGCTCGC
TGCTCGCATAGGAGACTTCATGCTGCATCTGGTGGTCCCTATGCTGCTGGTTTCGTGCTACTTGCCGTTTGTTCGTGTGTGGATGAGCGTGCCGGCTTTA
ATATCGTCGCGACTGTGGAGCCACTTCGTGGTTGGCGGTGGCGTGTTCCCCAAGGCAGACCACATCTATCGCTTCTCGCCGCCGAGGTCGCAGCACTTTT
GGAACGCTGCGTACAAGATGGAGCTCATGTTGAACCTGCTGGTCCCGCTCTTCTGCGTCCTGGCACACCAGAGATCTTTCTGGGTGTACGCCGCGACGGC
TATCGCGGGGGCAGTTCTGTTCTGCCTCCAGCTGATCCGGTCGCTTTCTCTGCCTAAACTGCGGCGAAATGCAAAGTCGATCATGTGCCGCTTGTTGTCC
AGCGGCGGTATCCGACCGAATCTGGCGTACATGGACGGATACTTCCACCAAGGCTTCGGCATTTGGACTGCAGGGACTTTGTCGATCAATGTTGCGCAGG
CTAACAAGCTTGCAAACTTGGATCAGCTGCTCGACATTCGGACTGGTCATACTGTCCTAGATATTAGTGTCGGCTCGTGGGGAGGAGTGGGCTGTTACCT
CGCCCAACAGCACCCCGACGCCACTGTTGTATGCATACTCTCCTCTGTCCAAGAGTTTGCACGTGCCAAGAAGTTCGCTCGTGATCTCGACGTTCTCGAC
CAAATGGAGTTTGTACTTGCTGAGACTCCGGATAATTTACTGACAATTCTGAGCGGCTTCCGTGCGTCCAAGTTCGACCGCATCACGCTGTGCGGTGTGG
CGGAGACTGTGCCTGATCTGCAGAAGACGCGATTCCTACGCACACTCAAGCGTACCCAGACTACAAACGGCACCACGCTCCTGGAATTCAGCGCATGTAC
GGCCGCACACATGACGACCCACGCCTGGACCAACAAATACGTGCACAGTGCGTACCCTTGCTACGCTATCACGCTGCCACTCATGCGTCGACTAGTCGGG
GAGACGGGCTTCACGCTTCGAGACACAGTTGGGTACTCGGATCACTACGAGCGCACATTCCTCGAGTGGAACCGTCGATTCCAAGTACAGTGGGGACATG
ACTCAACACCAAGTGCAGTTGACCAGACTGCACCAGCGGACCAAACGACCGAGCTACCGCGCGTGCAATCGCTCCCCGAGTCCTTCAAGCGCACGCACTT
GGACGCCATGGATGGCGAGTGGGAAAGGCACGCGGACGAGGCCTCCGGTTCGGCGTACTACTACAACGTGCGCACGGGCGAGTCGTCGTGGGAGGTGCCT
GCGGGTTTCAAGTCGCCGCGGGCGCAAGAATCGATCGAGAAGGAGGCCCCCAAGTGGCGCGAGTTCGTGGACGACGAGTCCGGGGCCACGTACTACTACG
ACGAAGTGAGCGGCACTAGTCGCTGGGAGAAACCGGAGGGGTTTGCACTGGAGAAGAAGAATACGCAGCAACAAGAAGTAGAAGAGCAGGAGATAGGGCA
ACCGCAAGAGGAGACGGTGGAGACGACACCGGAACATGCCGTGGGAGTGAAGAAACAGGAGGTGGAAACGCTGGAGAAAGAAGGAGAAGAGACTGCATCT
GCTTCTGCCCAGCAGTGGGTCAAATATGTGGACGCGAACAGCAACAAGCCGTACTTTTACAATGCCAGCACGGGCAAGACGCAGTGGGAGGAGCCCGAGG
GCTTCGACGAGTCTACAGCAGCTACGCCGGCAGGTGCCCAGGTGTCCGCCGAGTATCAGGCCCATCTTAACCGGATGCGCACGGAGCGCCTGGCACGAGT
GACCCAGCAAGTGTTGGACCCGTCGGGTAACCTCAGTAAACTCAACGCCATTTTGAACAAAGTTGACAGTAGCGCGTCGCCTGTTCCGGTTACAGCGGAC
GGGGAGGAGGCTGCAAACACCCCACGGACAGCAAAAGCGGAATGGCAGCAGCATATCGACGCGCAGACGCAGCGATACTACTACCACAATGTGGTAACGG
GAGTTACGCAGTGGAACAAGCCGGATGCGCCTATTGTGTCAGGGCTGGCCAATTGGATCCCGCCCGAGGTCCCGGAATCGGATGAGTCTCGTGCAGGACA
GAAAACTGTATCGGGCGTGAACTACGTTGCACGTGCCAAGTTTAACCGACTTACAGGAAAGTACGAGCAGCTCGGCGGCGAGGACTATTGGCAACACGCT
GGAATTGCTCCGGATCGAGCTGGGCGACAAATGAGCCATTTCTTTGATATGACTGAGCTCGAGAAGAACCGCGAGGAAGCGCAGCGCAGAAAGGAGCAGC
TAAAGCGCAAAAATATTGACTGGAAGAAAATAACAGCAGAGAAGAAGGCCAAGAAACAGAAGCAGAAGAACGAGTGGCTCTACACCGATTAA
	
	
WRKYRTTAILYMLMPCCWPWCSCRRSFVCESCTHSCGTCSPSSPSRWSLVRRRDSLRSWGCR_CCRGICCATSTAPCSTACCSAGSAS_ASTASSADSRT
LAISCCTLCVRWRSLPSTWSTSKCGWRCRSWASRCCGCTSSRAARWLRTTCITSRRRARCSSGPWPVPPCSWATSRCRWAAFLHSAAVCLTCWSAAWKSP
GRWTPPSSSPWRTIH_RTRCSRCAMASSGWVQLLLRARCRR_AQTPCKRWCCCSLWRCCRCWCASGSSTRSAGWPSRCWLT_PGRRRHWALPRRWGSP__
WAGTRCACLTAPRSWASCRAGSAS_ASTGPSGCWPTPSTSCCTWACHSRSHSATCRSYGCG_QSLSCSSRSSGSSWLLAGTSP_EATTSTTSTHRAPRHS
GWRLARSNWSTISPFPRSR_WRRC_TGEC_AVATATPPSPTTKWTRRWP_RCCSASWYCLRSWVSAPCTPTAGSPSPSSRTCWRPRPRWVSPHPWASPSW
SVGTRCACLTDTPSRPSSTAGSGSGLARRCSGSLLA_ETSCCIWWSLCCWFRATCRLFVCG_ACRL_YRRDCGATSWLAVACSPRQTTSIASRRRGRSTF
GTLRTRWSSC_TCWSRSSASWHTRDLSGCTPRRLSRGQFCSASS_SGRFLCLNCGEMQSRSCAACCPAAVSDRIWRTWTDTSTKASAFGLQGLCRSMLRR
LTSLQTWISCSTFGLVILS_ILVSARGEEWAVTSPNSTPTPLLYAYSPLSKSLHVPRSSLVISTFSTKWSLYLLRLRIIY_QF_AASVRPSSTASRCAVW
RRLCLICRRRDSYAHSSVPRLQTAPRSWNSAHVRPHT_RPTPGPTNTCTVRTLATLSRCHSCVD_SGRRASRFETQLGTRITTSAHSSSGTVDSKYSGDM
TQHQVQLTRLHQRTKRPSYRACNRSPSPSSARTWTPWMASGKGTRTRPPVRRTTTTCARASRRGRCLRVSSRRGRKNRSRRRPPSGASSWTTSPGPRTTT
TK_AALVAGRNRRGLHWRRRIRSNKK_KSRR_GNRKRRRWRRHRNMPWE_RNRRWKRWRKKEKRLHLLLPSSGSNMWTRTATSRTFTMPARARRSGRSPR
ASTSLQQLRRQVPRCPPSIRPILTGCARSAWHE_PSKCWTRRVTSVNSTPF_TKLTVARRLFRLQRTGRRLQTPHGQQKRNGSSISTRRRSDTTTTMW_R
ELRSGTSRMRLLCQGWPIGSRPRSRNRMSLVQDRKLYRA_TTLHVPSLTDLQESTSSSAARTIGNTLELLRIELGDK_AISLI_LSSRRTARKRSAERSS
_SAKILTGRK_QQRRRPRNRSRRTSGSTPI