Scaffold : contig_25
Gene_id : Phyra_g6161
Description : hypothetical protein
TGTCGCTCCCAGTCACAAGCTGGAAGCGTTTCGCTCGCGACCTGCACGATGGACGCATCGAGCAGATCTTCATCCTCTCGGACGTCGAGAGGATGACGTG
TGAAGCAGAAGAGCTGAATCAGCTCATCTCTGAGGGAGCGGACGCCCTCAGCGCGAAGTCGAAGAAGGAACGCTTCGACGAGCAAGGCTGGGATTCGCTC
AAGGCGAGACCCTTTTACAAGGTCTTGCGTGAATACAAGGATGTACTCCCGGACGACATTCCTGCGGAGTTACCGCAGGACAAGGGTGTCCAGCACGAAT
TGATCTCGTGCCGGGAACGAAGTATTGCGTCACGCGACAGTGGCCACTGCCGCGTGAGCAAGTCAAGGCAATCGACGACTTCTTTGAAAGTCGTCGCAAG
GCAGGACAAGTGCGGGAATCGAAGTCCCCGGACAGCGCGCCTACGTTCTGTGTCAAGAAGCCACAGGGCGGGGTGGCGCATCGTTCATGCGTATAACAAG
CTGAACGATGCGACGGTACCGGCGCAGACGCCGATACCTCAAAATGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGTACTCTGGATCTGA
GAGACGGGTTCTATCAGATCCTCATGCGTGAGAGTGATATCCCTCTCACGGCGGTAAGCACTCCGAGCGGCATGCTCTGGGAGTGGCTCGTGATGCCGCA
GGGGCTGAAGAACGCCCCAGCGACGTTCAACAGGTGCGTCACGCACTTGTTGCGCTCGGTGCGCGACTTCGCACCGAGCTATTTCGACGACGTGTTCATT
CACAGCCGGGCTGTGAATGGAAAATCGGATGTGGAGATGCACACAGAGCATCTCCGCAAGTTGCTTGAGCTCATGCGAAAGCACAAGCTCTACGCGAACC
TGAAGAAGTGTATCTTCGGGGCGACCGAGATACCCGTACTTGGGTGTCTCGTGGGGAAGAACGGCGTACGCCCTGACCCAGGAAAGGTCAGAGTGATCAA
TGAATGGCCTACGCCTTCAAACGTAAAGGAACTGCGGCAGTTCCTTGGACTCGCCACGTACTTGTGCAAGTACGTGAGCAACTACGCGGGCAAGAATTGC
CCGCTGTCGCAGCTCTTGAAGAAAGAAGCTGCATGGGAATGGACTGCTGATTGTCAGCAGGCCTTTGAAGCAGTCAAGCAGGGCTTGACTGAGGCGCCAA
TCTTGGCGGTGACCGACCAAGATCGCCCATTCCACGTTGTGTGTGATGCATCCGATTTCGCGATCGGATGCGCATTGATGCAACACGATCACGAAGGTGC
AAGAGGCCGACGACTACACTCTCGTCGTCCATGTTAGATGACGTGAAGGCCACATACGCGCATGATGCGGATGCGAAGCAATTGTTGGAGTATTTCTCCA
CACCTTCTGACAAGTCTCGTCAGAAGCTGGCCAAACACCTTCGTGCCCGTGTACACCGTTATCGTGTACACAATGGTCTGCTGCTTTACAGCGCAGTCGA
CGCCAACACAGATCGCATTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTACGAGTACCACGATGCCCCGACATCGGGACATCCTGGCCGT
GAGAAGACATATTGCTTCTCATGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAAGTACGTTCGTACTTGCGAGGTATGCCAGCGCGTGAA
GCCTGCGCCCAACTCGCAGGCTCCGCTTCAATCACTACCGACTCCGTCGGAGTGCTGGCAGTCCATTTCAATGGACTTTGTTTTTGGTCTTCCGCAAGAC
AACAAGCGGAGGACTGGTATTGTGGTCTTTGTTGACCGCTTCAGCAAGATGGTGCATCTTGCTGCAGTACCAGCCGAGGTGACAGCCAAACAGACGGCAT
GTCTGTTTGTCGACATGGTGTTTAGACACCATGGTATGCCACTCGACATCGTGTCGGATCGGGATCCGCGCTTTACAGCGCGATTCTGGCAAGAAGTGTT
TACACTTCTTGGGACGCAGTTGTCCATGTCGACTGCGGATCACCCGCAGACCGACGGACAAACAGAGCGTGTCAACCGCGTGCTGGTTGACACCATGAAG
AGCTACGCGCACTCGTTCCATCAATGGAGCGACTGCTTGCCGATGGCGGAGTTCGCCATCAACAACTCGGTGCATGTCTCGACAGGACACACACCGTTCT
ACGTGAATGCCATGAGGCACCCACGCGTACCGAGCGTACTCGGTGCGGTAGCTCCTTCCTTAAGTGGGGGAGGATATCCGGTTAATTCAAAACAACCGGA
TAAGCACGCTGATACAAGCAATGTATCAGCTGTGACGACTCGCGCACGTACTGCGCGCAGTCATGGCGACGACAAGACAGTGTCTACGACGGGCGTAGAC
ACTTTAAACGACAACGAACATCACGCGCAGGCCGGGCCTGCTGCGAACAAGGAGCACGAACTGAACCAGGGGTTCAGCTCGGATGCAATGGACTTTGTCC
AGCGTCGACGCCGTAATTCGGTTTGTCCAAGATGCAATAGCAGCTTCTGTCGATCGACAGAAGCTGAATGCCGATAACACGGCAGGGGAAACACAAATGA
ATTCAAAGTTGGTTCATTAGTTCTGTTAGCTACGCAGAACCTAGCTAAACATGCAGTTTCCGATTTCGGAGCAAGCAAGCTTGCTCCGCGCTTCATTGGG
CCATTCACCGTGTTGGCGAAGCATGGCAACGCGTACACACTGGACATACCGTCCAGCATGCGCTTGCACCCAACGTTTTACGTTGGGCGACTGAAGCCGT
ACGTGCAGCACGAGTCACCTACGTCTGGTGACTCGCCAAAGCGCTCTCGAGCGCGGCGACGCGCTTCGAACGCCAGAGAGCCTCGTCCCGACCTCGACCT
TTACGTTCGAGGTCGTCTGCGCAACCTCCGCGAGCTGAGCCTTTA
	
	
TGTCGCTCCCAGTCACAAGCTGGAAGCGTTTCGCTCGCGACCTGCACGATGGACGCATCGAGCAGATCTTCATCCTCTCGGACGTCGAGAGGATGACGTG
TGAAGCAGAAGAGCTGAATCAGCTCATCTCTGAGGGAGCGGACGCCCTCAGCGCGAAGTCGAAGAAGGAACGCTTCGACGAGCAAGGCTGGGATTCGCTC
AAGGCGAGACCCTTTTACAAGGTCTTGCGTGAATACAAGGATGTACTCCCGGACGACATTCCTGCGGAGTTACCGCAGGACAAGGGTTGGCCACTGCCGC
GTGAGCAAGTCAAGGCAATCGACGACTTCTTTGAAAGTCGTCGCAAGGCAGGACAAGTGCGGGAATCGAAGTCCCCGGACAGCGCGCCTACGTTCTGTAC
GCCGATACCTCAAAATGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGTACTCTGGATCTGAGAGACGGGTTCTATCAGATCCTCATGCGT
GAGAGTGATATCCCTCTCACGGCGGTAAGCACTCCGAGCGGCATGCTCTGGGAGTGGCTCGTGATGCCGCAGGGGCTGAAGAACGCCCCAGCGACGTTCA
ACAGGTGCGTCACGCACTTGTTGCGCTCGGTGCGCGACTTCGCACCGAGCTATTTCGACGACGTGTTCATTCACAGCCGGGCTGTGAATGGAAAATCGGA
TGTGGAGATGCACACAGAGCATCTCCGCAAGTTGCTTGAGCTCATGCGAAAGCACAAGCTCTACGCGAACCTGAAGAAGTGTATCTTCGGGGCGACCGAG
ATACCCGTACTTGGGTGTCTCGTGGGGAAGAACGGCGAACTGCGGCAGTTCCTTGGACTCGCCACGTACTTGTGCAAGTACGTGAGCAACTACGCGGGCA
AGAATTGCCCGCTGTCGCAGCTCTTGAAGAAAGAAGCTGCATGGGAATGGACTGCTGATTTCGACGCCAACACAGATCGCATTGTCGTGCCGGATGATCA
TGAGCTGAAGCTCAAGATCACGTACGAGTACCACGATGCCCCGACATCGGGACATCCTGGCCACAACAAGCGGAGGACTGGTATTGTGGTCTTTGTTGAC
CGCTTCAGCAAGATGGTGCATCTTGCTGCAGTACCAGCCGAGGTGACAGCCAAACAGACGGCATGTCTGTTTGTCGACATGGTGTTTAGACACCATGGTA
TGCCACTCGACATCGTGTCGGATCGGGATCCGCGCTTTACAGCGCGATTCTGGCAAGAAGTGTTTACACTTCTTGGGACGCAGTTGTCCATGTCGACTGC
GGATCACCCGCAGACCGACGGACAAACAGAGCGTGTCAACCGCGTGCTGGTTGACACCATGAAGAGCTACGCGCACTCGTTCCATCAATGGAGCGACTGC
TTGCCGATGGCGGATCATGGCGACGACAAGACAGTGTCTACGACGGGCGTAGACACTTTAAACGACAACGAACATCACGCGCAGGCCGGGCCTGCTGCGA
ACAAGGAGCACGAACTGAACCAGGGGTTCAGCTCGGATGCAATGGACTTTGTCCAGCGTCGTCTGCGCAACCTCCGCGAGCTGAGCCTTTAA
	
	
CRSQSQAGSVSLATCTMDASSRSSSSRTSRG_RVKQKS_ISSSLRERTPSARSRRRNASTSKAGIRSRRDPFTRSCVNTRMYSRTTFLRSYRRTRVGHCR
VSKSRQSTTSLKVVARQDKCGNRSPRTARLRSVRRYLKMM_SSIR_PRVLSSVLWI_ETGSIRSSCVRVISLSRR_ALRAACSGSGS_CRRG_RTPQRRS
TGASRTCCARCATSHRAISTTCSFTAGL_MENRMWRCTQSISASCLSSCESTSSTRT_RSVSSGRPRYPYLGVSWGRTANCGSSLDSPRTCAST_ATTRA
RIARCRSS_RKKLHGNGLLISTPTQIALSCRMIMS_SSRSRTSTTMPRHRDILATTSGGLVLWSLLTASARWCILLQYQPR_QPNRRHVCLSTWCLDTMV
CHSTSCRIGIRALQRDSGKKCLHFLGRSCPCRLRITRRPTDKQSVSTACWLTP_RATRTRSINGATACRWRIMATTRQCLRRA_TL_TTTNITRRPGLLR
TRSTN_TRGSARMQWTLSSVVCATSAS_AF