Scaffold : contig_1
Gene_id : Phyra_g6
Description : hypothetical protein
ATGGATCGCAGTGAGTTTCCTCACTTGAACGACTCGCAGTTTGAGTCCGTTCGGAAGATGGCGGGCATCTTCGGGATGGATACCCTCCAGAGCTTGGCGG
CAGCAACACCTGCCGAACGGCTCGAGCGCGTAAGCGCTTTCGACACGTACGAGCAAGGGCTAATCGCCCATGTACGTGGGAGCCTACAGGCCCCTGTGGC
TGAACGGAAACCAGTTCAGCCTAAGCCTTTGAGGCTGAAGGTTAACCTCTACGAAGGAAAAGAAGGGGGAAATCTTCACTTCTGGGTCCCGAGAGATCGA
GCTCGCTGTGGACACGGCTCTCGTCTCGGACGAGCGACTCCGCGTCGCTTTTGCTCTCTCCCACCTAAGTGGTCGAGCAAAGTGCTGGGCGTATACGCGC
GAAGCGACAACGCCTGGATGCTTTGCATCCTGGGCTCAGCTGTGTGAGCAGCTTCGAGCCGCCTTCCTCCCGGCGAACTATGAGTACCGCCAGCGCTCAC
GCTTCCTTGCGTGCAAGCAAGGGAGACGTGAGCTGTATGAGTACATCCAGAAGATGCGGGAGCTTACCGCATCTCTGGTGGGAAACCCACTCCATAAACA
CGGTGTTCATGGACGGCCTACGAGTAGGCCCAGCGCGCACGCAGCTGTTTCGGGTGCAAGCAAGCACCCTGGAAGAAGCGATTCAAATTGCTCTTCAGGA
GGAGTACAGCCATCGACAGGCTCGCACTCCTGCCACTGCGTGGCTTGGGGGCTCCACTCAGGGCGGGCCCCAAAGTAGGGGCCCCTTCAACGGTCCTGTG
CCGATGGACCTGAGCCTTGCCGAACAGCACGACATGCGCTGTTTCGGCTGTGGCAAACTGGAGCACATGAAACGTGCGTGTTCCGCGGGAGGAACAACCC
GGCGGTTTCCTTCCAAGCCCTTCGGTCCTAGGGGTCGCTGGCAAAAGCCACGACCCCGTGGCCAGGGGAACGCAGGGAACCAGTAGGGGCGGGGAGCCCT
ACTGGGGAAGATCTAAGTCTTCATGAGTGGTGCGCGGGTGGTGCGCACCATGAAGGCTTAGCCCCTGAGAGTCTCTGTACTCTCGAAGCGGAGAAGGGCA
GAGGAGGGCTGCTTGTAGTACATGCAAATGTACGGGGATACGATCATCCCATGAGAATCTTGATCGATTCTGGGGCGTCAAAGAACTTTGCACGCCGCCG
GACGGTCGCTCGCAAGAGCGACCAGTTCACCGATGCTTTACGAGAAAGCAAAGGGAACGGGCATGTCCTAGTCAGACTGGCTGACGGGACTGTAGTGGAG
GTGCCCAAGGTCTTTATGAACCTGTCCGTCAAGTTTGAGGACTTAATTCCACTGAACGATTCCTCGTTCTTGATATGGACAAGTACGACTTGATCCTGGG
CATGCCATGGCTTGAGAAGCATGAGCCCTGGATAGACTGGCGCGGCAAAGCCATCGGGGCTAGCCGGCCTGTTGCTACTAACAGAGCATTGGTGAGTCAT
GTTCCCACCTCTGTCAGCAGCCGGGCCTACCACCGGAGCCGAGTCAGAAACGACTCCGAAGAATTAGTTGCGGCAGGAGCCGCAACAGGTGTCATGACAC
CGTCCACGGCGGGCAATGGGCCGCCACAGGCAATGCCGGTGGACAGGACTTCGAGTCCAGCGAGGGGAACTGCAATGCCAGCAGTACCCACCGCTCCTGA
CTATGGCACCGTACGGCCTTCGGCCTTGTCGACGCCGGGGGAAGTCAACTCCCCAAGGGAAACGAGCCCACGTGAGACCAAGGAGGTCGAGACCGTGGCC
AGGGTCGAGGTTGCTGGGAGCACCTCTAGTGTGGGTAACAATGTACCACACGGAGTCGATGGAACTCCCGACTCCACCCTTGAGTCACCACCGGCTGTGG
GTAACAAAGGACCACGCCGTGGTGGGCATCGACGACGTCATCGCCGCCGTAAGCTGAGTCTGTTGAGACAGACTGGAGTCGCTACAGAGAGAGAACTCTC
CTCAGGCACGGCCGGCCGAAGAATTCTATTACTTCTTCGACGGCGAGACCGGGTGTACGGTCAAGGCGGACTCCACAACATTGGCAGCTCTGCCTGAGGT
GTCCGAGCTACTGAACCTCGAGGAAATGTCGATGGACGATTTCCTGGCACAATTGAAAGCCGGGGCAATCGCGGAGATGGTGCTCCTGAAGCCGGAGGCC
TCTCCAGAAGAGCTGAGCTCCTCTTCCGTTATGGACAAGGATGTCCTGGGCGAGCTTGGTAAGAAGCGCGCAACGCGTACGGGCTCTGCGATCCTCGAGA
ACCCCAAGGATCCAGTGTATCCTTTGGTGAAGGAGTTCTCGGACGTGGTGTCCAAGGACCCGCCATCCCAACTCCCACCTGACTGAGGAGTTAGGCACGA
GGTTGATCTCGTGCCAGGCACAAAGTACTGTGTGACCAGGCAATGGTCACTGCCTCACGAACAGTGCGAGGTCATTGATGCCTTCTTCGTCGCGAAGGCA
AAGGCAGGCATGGTGCATGAGTCGAAGTCTCCGCACTCGACGCCCACCTTCTGCGTTCGCAAGCCGAACGGGAAGTGGCATCTGGTTCATGCTTATAACA
AGCTGAACAGCGCAACAGTGCCCGCCCAGACACCCATCCCTCGCAAGGATGTGTTGCTGAACAACATGACGGGCTGTGAGCTTTTAAACGCGCTGGATCT
GGTGGATGGATACTACCAGATCCTGATGCGCGAGCGCGACATCCCGCTCACGGCGGTGAGCACCCCGAACGGCATGCTCTGGGAGTGGCTAGTGATGCCA
CAGGGTCTATCAAATGCCCCAGCGACTTTCAATCGCTTGGTCACACAGTTGTTTAGACCCTTGCGTGCGTTCACGCAGACGTACTTTGACGATAACTTCG
TCCATAGCCGTGCCGAGGAAGGCAAGACGGCTATCAAGGTGCATCTCGAGCACCTCCGTCGAGTGTTCATGGTCATGAGAGCAAACAAGCTCTATGCCAA
CATCGACAAGTGCGTCTTTGCGGCACAAGAGATCAAAGTTATCGGCTGCTTCGTCAGCAGCGTCGACGTTCGAGCCGACCCTGAGAAGGTCAAGGCCATT
GCGGCCTGGCCCACACCACGATCCCAAAAGGATCTTCGCAAGTGGTTGGGCCTCGCCAACTACTTGCACAAGTATAGTGCGGGGTATGCCGGGCTGGCAC
GACCCCTGTCGGATCTCCTTAAGAAGGATGCCGACTGGCGCTGGGAGAACCGTCATCAGGATGCATTCAACAGCATCAAGGCGAGCTTGCAGTGCGCGCC
GGTTCTGGCCTTGCCGGACGAGACAAAGCCATTCAGCGTTGTCTGCGACGCCTTCGACTATGCCATCGGTTGCGCGCTGCTGCAACACGACGCGGACGGG
CACGAGCGAGTCATCTCGTTCCAGTCCAGGCAGCTTAAAGCTGCCGAGAGGAACTACCGTGTCCATGACAAGGAGCTCCTCGCAATGAAGTATGCCCTTG
TCAAGTTCCGGGTACACCTCCTGGGCTCTGAGCCCTTTGTGATCTATACAGACCACGAGTCCTTGCGGACGGCCACCAACTCTCCGCATCTGTCTCAGAG
GATGGCCCGCTGGCTGTCATTCTTCGCGGAATATAACTTCCGCGTCGAATACAAGCCGGGCAAGCTGAACGTGCTTGCCGACGCGTTATCACGTCGACCC
GACTATGAGCTCGCGCACATTAGTCGGGTTACGACAGATCTATATGATCGGATACGCTTGGCATATCGAGATGATGAGAATCTCTCTCCCATCGTGCGGT
TCCTCACCGCTGGCAAGGAGGTCAAGCCTGCATGGCTAACGCCCCGCCAACGTGCCCGACTCCGTCGCTATGCGTGGGTCGATGGCCTCCTCCACTACCG
CGTGGACCCGGCCAATCCTCCGCGGATAGTCGTCCCCAACGAAGAGGATCTGAAGTATGACATCCTTCAGGAGGCGCACGATGTGCCTTCCAGCGGCCAC
CTTGGCCGCGAAAAGACCTTCTTGTCGGTCTCCCAGGTCTTCTGGTGGGCCCACATGTACAAGTGGGTCGTCACGTATGTGAAGGCCTGCGAGACATGCC
AGCGTGTGAAACCTGCTGGTCATGCCTCGGCTCCTTTGCAGAGCCTGCCAGTCCCAGAAGACTGCTGGAAGTCGATGAGTCTCGACTTCGTCTTCGGACT
GCCGGCTGATGCCCAGGGCAACACCGGCGTCCTGGTGTTTGTCTGCCGCTTGAGCAAGATGGTACACCTTGCTCCGGTGGCTGACTCCGTCACCGGGGAA
CAGACTGCAAGGCTGTTCCTGGATGGCGTCTTCCGCTATCATGGCCTCCCTGAGACTATTATCTCTGACCGTGACCCAAGGTTCACGTCTGCGTTTTGGA
AAACGCTGTTCCACTTGCTTGGAACACACTGCTCATGTCCACGGCCGACCGCCCGCAAACAGACGGCCAGACGGAGCGCGTCAATCGCGTCCTCGAAGAC
ACTCTACGCAGTGTCTGTGCCGAATCTCCCGGCACATGGTCGGCCAGTTTGCCGATGGTTGAGTTTGCACTCAACAACGCGGTACACGCGTCCACGGGGT
TCTCTCCGTTCTACCTCAACGGGCTCCAGAACCCCCTGGTGCCACTCACTCTCCGTGGTGACACCGTGGCTTCGGTCGTAAGTGGGGGAGAGGCGCGGAA
AGCTCTTTCCTCCCAGGTGTCAGAAGTGACACCGGCTTCCCTAAAGAAGCAGTTGTCGACTTTTGTCGACAACAGGCTTAATGTGATAAGCCGGGTGCGC
GACACAATGGCCGCCGCCCAAGATAAACAAAAGGAGTACTCTGACCGACATGGAAGAGGAACTTAAACGTGTTCAAAGTGGACGAGTTAGTACTAGGAAC
CTACCACTAAACTCGGTCAGTTCCGTGCTCAGCAATAAGCTGAAGCACAGGTTTATCGGACCCTTTGAGGTCCTGAGCAGGCATGGTTCCGCCTACACGA
TCGACTTGCCTAAGTCGATGACAACCCACCCGACGTTTTATGTGGGTCGTCTGAAGCGCTACCACGACACTCAGGCTTCTGATCCCCCGCAGGAAGCGAA
AGGGGATTATGAGGTGGCGAGATCACCACCTCGAACCGAGCGCTCGCCTCCCGCTGTGGCGACCGCCACGCGGAAGCCGGCACAGGGGACTGGTCGT
	
	
ATGGATCGCAGTGAGTTTCCTCACTTGAACGACTCGCAGTTTGAGTCCGTTCGGAAGATGGCGGGCATCTTCGGGATGGATACCCTCCAGAGCTTGGCGG
CAGCAACACCTGCCGAACGGCTCGAGCGCGTAAGCGCTTTCGACACGTACGAGCAAGGGCTAATCGCCCATAGAGAGAACTCTCCTCAGGCACGGCCGGC
CGAAGAATTCTATTACTTCTTCGACGGCGAGACCGGGTGTACGGTCAAGGCGGACTCCACAACATTGGCAGCTCTGCCTGAGGTGTCCGAGCTACTGAAC
CTCGAGGAAATGTCGATGGACGATTTCCTGGCACAATTGAAAGCCGGGGCAATCGCGGAGATGGTGCTCCTGAAGCCGGAGGCCTCTCCAGAAGAGCTGA
GCTCCTCTTCCGTTATGGACAAGGATGTCCTGGGCGAGCTTGGTAAGAAGCGCGCAACGCGTACGGGCTCTGCGATCCTCGAGAACCCCAAGGATCCAGT
GTATCCTTTGGTGAAGGAGTTCTCGGACGTGTGCGAGGTCATTGATGCCTTCTTCGTCGCGAAGGCAAAGGCAGGCATGGTGCATGAGTCGAAGTCTCCG
CACTCGACGCCCACCTTCTGCGTTCGCAAGCCGAACGGGAAGTGGCATCTGGTTCATGCTTATAACAAGCTGAACAGCGCAACAGTGCCCGCCCAGACAC
CCATCCCTCGCAAGGATGTGTTGCTGAACAACATGACGGGCTGTGAGCTTTTAAACGCGCTGGATCTGGTGGATGGATACTACCAGATCCTGATGCGCGA
GCGCGACATCCCGCTCACGGCGGTGAGCACCCCGAACGGCATGCTCTGGGAGTGGCTAGTGATGCCACAGGGTCTATCAAATGCCCCAGCGACTTTCAAT
CGCTTGGTCACACAGTTGTTTAGACCCTTGCGTGCGTTCACGCAGACGTACTTTGACGATAACTTCGTCCATAGCCGTGCCGAGGAAGGCAAGACGGCTA
TCAAGGTGCATCTCGAGCACCTCCGTCGAGTGTTCATGGTCATGAGAGCAAACAAGCTCTATGCCAACATCGACAAGTGCGTCTTTGCGGCACAAGAGAT
CAAAGTTATCGGCTGCTTCGTCAGCAGCGTCGACGTTCGAGCCGACCCTGAGAAGGTCAAGGCCATTGCGGCCTGGCCCACACCACGATCCCAAAAGGAT
CTTCGCAAGTGGTTGGGCCTCGCCAACTACTTGCACAAGTATAGTGCGGGGTATGCCGGGCTGGCACGACCCCTGTCGGATCTCCTTAAGAAGGATGCCG
ACTGGCGCTGGGAGAACCGTCATCAGGATGCATTCAACAGCATCAAGGCGAGCTTGCAGTGCGCGCCGGTTCTGGCCTTGCCGGACGAGACAAAGCCATT
CAGCGTTGTCTGCGACGCCTTCGACTATGCCATCGGTTGCGCGCTGCTGCAACACGACGCGGACGGGCACGAGCGAGTCATCTCGTTCCAGTCCAGGCAG
CTTAAAGCTGCCGAGAGGAACTACCGTGTCCATGACAAGGAGCTCCTCGCAATGAAGTATGCCCTTGTCAAGTTCCGGGTACACCTCCTGGGCTCTGAGC
CCTTTGTGATCTATACAGACCACGAGTCCTTGCGGACGGCCACCAACTCTCCGCATCTGTCTCAGAGGATGGCCCGCTGGCTGTCATTCTTCGCGGAATA
TAACTTCCGCGTCGAATACAAGCCGGGCAAGCTGAACGTGCTTGCCGACGCGTTATCACGTCGACCCGACTATGAGCTCGCGCACATTAGTCGGGTTACG
ACAGATCTATATGATCGGATACGCTTGGCATATCGAGATGATGAGAATCTCTCTCCCATCGTGCGGTTCCTCACCGCTGGCAAGGAGGTCAAGCCTGCAT
GGCTAACGCCCCGCCAACGTGCCCGACTCCGTCGCTATGCGTGGGTCGATGGCCTCCTCCACTACCGCGTGGACCCGGCCAATCCTCCGCGGATAGTCGT
CCCCAACGAAGAGGATCTGAAGTATGACATCCTTCAGGAGGCGCACGATGTGCCTTCCAGCGGCCACCTTGGCCGCGAAAAGACCTTCTTGTCGGTCTCC
CAGGTCTTCTGGTGGGCCCACATGTACAAGTGGGTCGTCACGTATGTGAAGGCCTGCGAGACATGCCAGCGTGTGAAACCTGCTGGTCATGCCTCGGCTC
CTTTGCAGAGCCTGCCAGTCCCAGAAGACTGCTGGAAGTCGATGAGTCTCGACTTCGTCTTCGGACTGCCGGCTGATGCCCAGGGCAACACCGGCGTCCT
GGTGTTTGTCTGCCGCTTGAGCAAGATGGTACACCTTGCTCCGGTGGCTGACTCCGTCACCGGGGAACAGACTGCAAGGCTGTTCCTGGATGGCGTCTTC
CGCTATCATGGCCTCCCTGAGACTATTATCTCTGACCGTGGCGAGATCACCACCTCGAACCGAGCGCTCGCCTCCCGCTGTGGCGACCGCCACGCGGAAG
CCGGCACAGGGGACTGGTCGTA
	
	
MDRSEFPHLNDSQFESVRKMAGIFGMDTLQSLAAATPAERLERVSAFDTYEQGLIAHRENSPQARPAEEFYYFFDGETGCTVKADSTTLAALPEVSELLN
LEEMSMDDFLAQLKAGAIAEMVLLKPEASPEELSSSSVMDKDVLGELGKKRATRTGSAILENPKDPVYPLVKEFSDVCEVIDAFFVAKAKAGMVHESKSP
HSTPTFCVRKPNGKWHLVHAYNKLNSATVPAQTPIPRKDVLLNNMTGCELLNALDLVDGYYQILMRERDIPLTAVSTPNGMLWEWLVMPQGLSNAPATFN
RLVTQLFRPLRAFTQTYFDDNFVHSRAEEGKTAIKVHLEHLRRVFMVMRANKLYANIDKCVFAAQEIKVIGCFVSSVDVRADPEKVKAIAAWPTPRSQKD
LRKWLGLANYLHKYSAGYAGLARPLSDLLKKDADWRWENRHQDAFNSIKASLQCAPVLALPDETKPFSVVCDAFDYAIGCALLQHDADGHERVISFQSRQ
LKAAERNYRVHDKELLAMKYALVKFRVHLLGSEPFVIYTDHESLRTATNSPHLSQRMARWLSFFAEYNFRVEYKPGKLNVLADALSRRPDYELAHISRVT
TDLYDRIRLAYRDDENLSPIVRFLTAGKEVKPAWLTPRQRARLRRYAWVDGLLHYRVDPANPPRIVVPNEEDLKYDILQEAHDVPSSGHLGREKTFLSVS
QVFWWAHMYKWVVTYVKACETCQRVKPAGHASAPLQSLPVPEDCWKSMSLDFVFGLPADAQGNTGVLVFVCRLSKMVHLAPVADSVTGEQTARLFLDGVF
RYHGLPETIISDRGEITTSNRALASRCGDRHAEAGTGDWS