Scaffold : contig_1
Gene_id : Phyra_g38
Description : hypothetical protein
TGGGTGCTCCTGTCTGGGACGCTGATGACCAACACCACTTCACGTTTTCCAGTGGCGGCATGATCGGCGAGCACAAACGTGAGCTGTGCGATGGTGGAGA
TGATAACGAGAGCAGCAGCGTCGTTGGTGATGGTGAATGTGGCGAAAGATCCTCAGATACTGACGGTGCACCATGGGGGTCATCACGTGATGAACTCCTG
CCTGCCGCATTGTTGAACAAGATATTGCGGTCAAGCTCAGTGTCGTCTATCAACAGCAGCTCAACGCAAGACCCACCTGCTCGTAAGAAGCGTGACGGAC
GGACGAAACTATACCTTAACGGGTATGAGTACACTAGAGCAACCAGCACGCAAATCAAAATCACGTACCGCTGTAGCTTTTATCGTAGCCAGCGATGCCA
AGCTAAACTCGAGTATATCGCAGCGGTAATGGACTACGAGTTTGCCAACAGCATTCCCCATACATGTATTCCGCCTTCGATGCGTGCACTGACTGATCGC
GACGCGAATGGTGCCCGTGACGTCACGGCAGCTATGCAGCGGGATGTTGACAGCTTGGCAACATCTACGGTTGCAACACCGCTTCAAATATGGGACGAGC
TGAGCACAAAGTACTACCAAACGCAAGAGGACAACACTGTGGTTCGGGGAATGGCCAAAGGTCAGATTATCAAGCACGTGTATCATGCACGAGCACTTCA
CTATGGGACGGACATGCACGGCCGCGTCGACGTGGCGTCGTTGGTCAACAACATCAAGGGCAGCAACTTCCTGTTTCTGCAGTTCCACCACGTGTGGGGC
AACACGAAAAAAAAGCTTCGCTGCAATATTTTCTCCGGCACGAGAGCATCACCCTCTTCCTCGACGGTACCTTCCGCTGCGTGCCGGACAAATTTGCACA
GTGCGTGGTTGTCATGGTCTATGATCGAGGCACCAAGCTGTATATACCGGTATTTTTCGTGCTCTACCCTTCGAGAAACTACGACACGAACTGGAACCTG
CTGCAATTTGTCTCGAACGCATGCGGTGAGGCTCTTAAGCCTAAAGAAGTTGTGTGTGACTTCGAAGCAGCTCTCATTAATGCAACGAGCGACTGGTTTC
CAGAGGCCTCCATCATAGAATGCTTATTTCACTTCAAGCAAGCTTGCAAGCGTCGAATGCTAAAGTATCGGATACATAAAGACCCAGTGAAGGTCGCCAT
GTTGCCTGGCATGCTGGACAAGCTCACGGTGATCGAAAAAACCAAGATCGAGAAGCAGGGCATCGGATGGGTCAAGAACGCTATTAACGAGCGGTGTGAG
AAAGACAACATCATCTACGCAAGCACTAAGTGGGTATCATTCTGGAAATACTTCGAGCACACATGGCTGACCGAAGTAGTGGAATGTTCATGACTTTAGC
AATGGCTTTGTCGCGCGCTCTGTAAGCCACGACCCAGACGAGCTGCTATGCAAGGTGCAGACTGGCAAGTTTACAAGTAGCTGCATCATCTACGACAACG
GAATACCTACCGATGTTTTTTTTCCTCGGGGGTTGCGCGTATTCAAACTGTCTTCACTATGTCACAACGTTTGAGATGACCAAAGTGATGCATAAAGGCC
GGCATTAAGTTCCCGAATCGGAATTCGCTACAGAGTGGAGCAAGCTTTTGACATTCTTAAAGGAAGGTTTCGTATTCTTCAGAGTGAGATTCCCCGCGCT
GTGATGACCTTCGAATTCAACCCAAAGTTGATTTTTGTACTCTGTTTGCTACGCAACTTCATCATTATAGAAAGCGATTTGTACTACAACCAGTTTGATG
TGCAGCGTGAAATTGCAGGTAACCCATATTAGGCACTTCGAAGGGTTTCTGATTAATCTGTGGGGACGTCGCGCAATGTCTGAATTTGGTTCAGCAACAA
CAAAAGAAGAGTTAATCACGCTGTCCAAGCCGCTCCCGTAGCAGATCCTGGTTTTCTCTCTCTAACGTACTTGGTACTCGCGACACTCCTGGCGCTCATA
AACGCGTTGGTGCTGAGCGGCACGGCGATCCTCCAGTATTTCATCTAATTTGTTTACCAAAGAATCTGTCTGTACCTAGACCAAGTTCATAAGGAAACGC
TGGTCATTGCTGGGTTGGGATATTTACTTTCGTTTCTTCTGCCCTGTTATTGAAGGCGATTTCTGTGACATAGGTGCATGCTTGTACGGGATCATGATAG
AGGCCGCGTTTATGGATACGTTTTTCTGTGTGTCGAACGCTCTATCTGGTGTCAGGTCTGCTATCTGGAGGAAAAATGACCTTTCTTGATGGTGCAAGCG
AGGCGTAAATTATGCGCTTGACAATCAAGCAATGGAAATTGCTACCTAACATCCTTGCCTCACGAAGCAATGAGAACCCTGGCCGGTTTTGAACCCAGGC
GCGGTGAGGTTTGCTTCCCAGATCTGCTGTCGAGCTGCCGCAGACGCTGCAACCGCAAATTTCCCCTGGTGTGGAGAGTTGGCAGTCGAAATTTGCTAGT
GAAGAGTGCGGACAATCTATAGCAGGAGGTGGCCTCGCCGAATTGTTGGTGTATCTGTGCAAAGTAATCCTGCAGAATGCAGTTATACTAAAGAACGAAC
TACCGAGTCACCCAATATGGCGCCATTCAGTTTTCCAGTGTGACGAATTTTACCAGTTCAAGCGTGAGTTGAACGAGTTACTTGGTACTATAGTGGCCCC
GACAGAACGGCAGCTGGAGAAAGCTATGCCTGTCGCGTCAAAACAACACTTGATGGTATGCATCAGGGTCTGAAAATGTCGGTTGAGAGAATTCGGAACA
GTTTGGGGCGTGTCGGCGGAACTTAACCGACATTGCTAAAGTGTTGTCTCCATTTACTGACGGGACGGCACTGCTGCTAAGATCGTTAGGGGTGATGTGT
CTGCAAGACCAACCGCAGTAATACCATTAGCACAAGATATAACGAGACCATCGTACGAAATGGGGCATGAAGGCGTGGTTCCGTGGCTCCGTGTCGACGG
AGTCGCAATGTTATGACTGTCCGAGAGTTGTGGAATGAATGGGAGAAAGGTCTTTCAGGCGGACGGTTCGTAAAGACATTGGAAAAGAACTTTGGAGCTA
AATTGTGTGGCAACGGAGAAGGCGGTTCTTCAATCACTGTCAAAAACCATCAACGCTGTGACGGTCACAACAGAATCAGTACTGAACAGCGGATCCATTG
ATAGCCACAAGGTTGATGACGTCGCAGTAGAGCATGTGGACGCTGTCAGAAATGCACACAGTAAAATCGCTGAACTGGTTGTCGCTCAATGCAGATGCAG
AAGCAAGGGAGCTAGGGAGCTAGGGATTAATGCACTCATTTACCCCGTACGACCCAGCAGTACAGCATCGCGGGCACTGCCATTCAGATAGCTCCGATAA
CCAATTCTTGAGATATATTGAAAGCTGAATGAAGAATGGAAACGCTCCTATTTCGCCCAGCATTTTTAATTTGATCGACCGTCTGTTAGGCCACGGAATG
GGCGAGAACCGGTCGATCGAAGACGCAACAGCAGTGTCACGAGATGTTGCGGGCTGTATGCAATCTGCAGCAACGATGTGTGATGTTGGCTCAGGCTCTT
CGTCGACGGTAGCGTCAAATTCGCCGGTACCAGGAGTTTCCGTAGAGATCGATAAATAAGCAGCAAAAAAAAAAACACCGTTCCTACACGCGCCGTTCAC
GCCGTTCTTTTATAGCCTCTTCAACTCCCGGTAGCGATAGCTACTGTGCAGCAAACAAGGCTAACCCTGACCAATCGTATCGACCATTTTTTGAGTCTCG
AAATGCATTCTTTCTCTTTTGGTGGCGTCCTTTCCGGGACTTCTTCACATGATAGCCGTGCACGCGTTGCTTGGGTAGGTGAGGTCGTTCGCGTTGCTGT
ACATAGGGCTCAACTGCGAGAAACGCATCCGCTACATCAGCTGGTGCTAGAGAGTTGTCGTTGGTACTAACACCCGTATCTGCGACAGCCGGTACCACCA
CTCCACACGCAGAGACAGATCTATTGAAGGCGACGTCACTTCCATTGTTTTTGGTGTTATCACTATATTCATCATTGGACGGCTCGTCCAAGCTGTACAG
CAGCCTATCCATGCGTACAGCTTGTGCACAGCTCGCACGCTGTCTTCGACAACGATGCACAGACTTGTGTTGAGCCGTCCAGCAATAGTACGCCCGCTAA
CTTCGCTCTGGATGAACGTAAAAAGTTGTCAGCTTCCTCTACCACGAGCCATTCATGTAGCGTGGTAAAGCCGATTCACCTCGTACCTTAGTGCAACACG
CACTAATGAATATATACAGGCTGACCACTCCACAGAGTGGTCCACATTCATAGCAAAGAGATATGACTGGTAGAAAGCAACATCTTTCTACCAATGAGAG
TCATTCATTAGATAGGGTTCTGCCATCCATCCAATGGCAGAACCTCTCATTAGAAATATCAGTTTTAGGAGGAAACCCCATTTACAATCAATACAGTTCT
CATTTGGCACCAAAGCTATCGTTCGGTTCCTTTATCTAGGTTTAAGTATACTTGTGGATACAAGTAGACTGGATCTAAGGTAAATACTCCTACGCTTCCT
CATACACGTGCGCACACGTGTAAGCTAAAGTAGTGGGTCTAAGCAGACCCATTACACCTGGTAGCACTTTGTAGCCCGTCCAACGACCGACTAAGAACAC
GTTCGTATGGAATACGAACGCGGGGTTGAGAACGCACCCTCGGACAGTAACATGTTCGTGGGTAGCCCAAACACGTCTGAAACGCATGTTGCGCGTGCAG
ACTGCCCCCACCTATCGGAACCAGAGTGGGAGGCCCTCCAACGACTGTCGACGGTCATTGGAGAAGCAGCGGTAGCAACGATGTTGTGTACGCTATCACC
GACGGAGCAACACGATGTTGTTCTGGGTTTCATCGTGAAGGAGCAGCGTGAAACCACTGCTCGAGCTTCGGTGTCGCCTTCGGCCACACCGCGCGTGGAG
TCATTGACACTCCACGTAAGCAGCTATGTTGGAAGAGAGGGGGAACCTCTCTTCCGTTGGCTTGTCGAGGCCGACACTGTCATTACTGCTCGACGTATCG
TCGACCTGTTGTCGAGGGTTGCGTTCGCCATGTCATGTCTTGACGGACGAGCAAGGAGTTGGGCGTACGAACGCCGACTCACAGACCCTACGTGCTTCAG
CGCGTACGAGGTGTTCAAGGAGGAGCTCAAACAAGCGTTTGAGCCCCCGCAGAACGAGTTCCGATCGAGGGCAGAGTTCCTCGATCTGCAACAGGGCAAG
CATGACGTGCATGCTTACGGACAAAGAGCACGATACTTGGTCTCGAACATCGTGACCAACCCGATCGACGAGGCGACAAAGGTCGTCACGTTCATGAAAG
GCCTTAGAGATGGGCCTATGAAGACTATCTCTTCCGAGAGTATCCAAATACTCTCGAGGCTGCAATTGGGCTCGCAATACAAGAAGAGTTTAGCCTGCGA
AAGGCTAAGCTGCATGTGAGCGTCCCGCGGCTGATGCCACGACCGGTGGTAAGGCCGTCGGGAGGACCGGAACCAATTAACCTCTCGGGTGCGACGGCTG
CTGGTTCCCAGCAGCGTCATGGATCAACAATGTTCATTGTTTCCGCTGCGGACACATCGGTCACTACGCCCGCGAGGGCACAGCACCTGTGCGCGCGACC
AGGAGCCGCGTGGCGATACTGGGTATCGTCACAGGCTAACAAAACACTAGAGGGACCAGCAGGGCGCCGGGCGTCCTGCTGGTGATGCGGTCGAGCGTGT
CGACATTGGACACGCTGTATTGAAGATCGCTGCCCCCAGTGAGAGTCAATATCACTGCAAGAAGCAATATGACAAGCCGAATCTTGTCATCCTGAAGGTA
AGCTCGAAGAGAGAGAGGTCTCTTCGTGCTCTAGTGGACTGTGGTGCGTCGAACAACTTTGTTCGACTGCAGAGTCTTCCAAGGCTTGACTTCGAGGAGG
TGAAAACACCTCGAAGTCTATTGGAAGTGAGGCTAGCAACGGGTGTCGTTGTTAGAACCGAGAAGCGTATCGTACGTGTACGCTTCTCATATCAAGAGAA
GAAGTTCGATATGGTATGGGGCATGCCGTGGCTTGCACGGCATGATCCGGTGATCGACTGGACGAAGCGCACGATCATGCACTTCGGGAGCAGCACATGC
ACCACGTA
	
	
TGGGTGCTCCTGTCTGGGACGCTGATGACCAACACCACTTCACGTTTTCCAGTGGCGGCATGATCGGCGAGCACAAACGTGAGCTGTGCGATGGTGGAGA
TGATAACGAGAGCAGCAGCGTCGTTGGTGATGGTGAATCTATGCAGCGGGATGTTGACAGCTTGGCAACATCTACGGTTGCAACACCGCTTCAAATATGG
GACGAGCTGAGCACAAAGTACTACCAAACGCAAGAGGACAACACTGTGGTTCGGGGAATGGCCAAAGGTCAGATTATCAAGCACGTGTATCATGCACGAG
CACTTCACTATGGGACGGACATGCACGGCCGCGTCGACGTGGCGTCGTTGGTCAACAACATCAAGGGCAGCAACTTCCTGTTTCTGCAGTTCCACCACGT
AAACTACGACACGAACTGGAACCTGCTGCAATTTGTCTCGAACGCATGCGTGAAGGTCGCCATGTTGCCTGGCATGCTGGACAAGCTCACGGTGATCGAA
AAAACCAAGATCGAGAAGCAGGGCATCGGATGGGTCAAGAACGCTATTAACGAGCGGTGTGAGAAAGACAACATCATCTACGCAAGCACTAACAATGGCT
TTGTCGCGCGCTCTGTAAGCCACGACCCAGACGAGCTGCTATGCAAGGTGCAGACTGGCAAGTTTACAAACCCTACGTGCTTCAGCGCGTACGAGGTGTT
CAAGGAGGAGCTCAAACAAGCGTTTGAGCCCCCGCAGAACGAGTTCCGATCGAGGGCAGAGTTCCTCGATCTGCAACAGGGCAAGCATGACGTGCATGCT
TACGGACAAAGAGCACGATACTTGGTCTCGAACATCGTGACCAACCCGATCGACGAGGCGACAAAGGTCGTCACAACCGAGAAGCGTATCGTACGTGTAC
GCTTCTCATATCAAGAGAAGAAGTTCGATATGGTATGGGGCATGCCGTGGCTTGCACGGCATGATCCGGTGATCGACTGGACGAAGCGCACGATCATGCA
CTTCGGGAGCAGCACATGCACCACGTAA
	
	
WVLLSGTLMTNTTSRFPVAA_SASTNVSCAMVEMITRAAASLVMVNLCSGMLTAWQHLRLQHRFKYGTS_AQSTTKRKRTTLWFGEWPKVRLSSTCIMHE
HFTMGRTCTAASTWRRWSTTSRAATSCFCSSTT_TTTRTGTCCNLSRTHA_RSPCCLACWTSSR_SKKPRSRSRASDGSRTLLTSGVRKTTSSTQALTMA
LSRAL_ATTQTSCYARCRLASLQTLRASARTRCSRRSSNKRLSPRRTSSDRGQSSSICNRASMTCMLTDKEHDTWSRTS_PTRSTRRQRSSQPRSVSYVY
ASHIKRRSSIWYGACRGLHGMIR_STGRSARSCTSGAAHAPR