Scaffold : contig_18
Gene_id : Phyra_g4596
Description : hypothetical protein
TGACAGAGCCACCTTCTGTGGTCCTCCAAGCAGTGAAAGAGTTCCAGGCCCTTGGACCCTTCGAGTTGGTGCCTCCACGACCAAAGGAGACTTCGTACAT
ATTCAAGTGGGGGGTTCGTGTCAAGTACATCGAGAACGAGAAGGAGGTCTTCGCGTGGGCTTGTTTGGCCGACGAGGCGTGTCGGACGTCAGGAAAAAAC
CTGTTCAAGCTCTATGCTGGCAAAACGACCATGGCCGTGAAGCACCTCCAGAAGATACACAACGTTGGCTCGCCGAAAACAAAGATAGCGACCGTCAAGA
AGCGCAAACACGACCATGATTACAACCACCTGTCATCGTCCGCCCTGTACTCAAACAACCCAACCCGGCTAAACGTGCTGATGACCACTCTCATGATCAT
CAACCATAACTTGACGTTTCGTATGGTGGAGTACGAAGAGGCAAGACTAATCCAAGCGCTACTCTATAAGGACGAGATGAAGGCCAAGATAACTACAAAG
CAGGTGAAGGAATCTATCGTGGAGCTGTATTCTTCAACACGCAAGGAGATCACTAACTACCTCCAAGAGAACCGAGAGGACTACCCGAACTTTACGCTCG
TGGCAGATTTTTGGACTTGCAAAACAACGCAAGACAAATTTCTTGGGTTGCGGGTTTACCTGGTGGACAAGGCCTGGGAGTACAAGTCCATTCTCTTGGG
AACGAGAAAGTTCAACCCCGCATATGGAGATCGTGATGGCGGCATTGTCAAGCCCTTCAAAGGGTGGTTGAAGCACATGCTCGAGGACTTTGGCTTAGCG
ACGAGCGATTTCTACGGGGCTACGAGCGACTCGGGGGTGACGTGAAATCGATGCTGTGCAAAGAACTCAATCTGCACTGGGAGTGGTGCTTCGCACACAT
GGCCCACGCAGCTACAAAGTCATCATGTGGTGTAAATGGAGCTGCTAGTGCTGCAGCTAACCCGGAGATGGCGGACTTAATCTCACGGATGGTAAGAACA
ATATTTCAGGTCAAGGTCGTGTCTGTCACTGGGAGCTTATTTGCAGAGCTCTGTAAGTCTAAGACTCAGGGTGCCTCCACGCGACTTGTTGGATATTCTA
CTTCACGTTTCCTGAGCATGACGCGTTCATTGGAGAGAGTTCTTGAGAAGTGGCCAGCAATAACTGCGTGGTATGAAGAGCGAGCTCGTAAAGCACTTCG
TGCCAACCAGCCACCACCAGAGTTCCCGTTGGCTAATCGCCATGACGACTTGGTTCATGTGTTGTCTGTGCTGAAGCAAATCGGTGAGATCAAGCGAACA
TGTCAAGCAGAGCATCCTGTTCAAGTCGACGTGCTCGTACAGTTGTATATGATGCGTATTCACGACCTCGACCCTGATCAGCCTTTGCCACACTACCTAT
CAACCGACAAAAATCCTCGTTGGATTCCTGCAAGTGACCTTACACCACTGGCTGCGGATGTACGGAGACTATTGCGGAGAGCATTGGACGAACGCTTCTT
CAGCAGATATTACAACGACAAGCAATTCCACAAGTGTCAATTTGTATTTGAAATGCAGTTGAAACTCCACCCTATCTTCAAACGAACGGAGAGGAGCCTC
GATCGTGCAGTGATTTTGTCGTGCCGTCAGCATGGCAAAAGCGGAAGGGATGCTGTGACCAGGAAGAATGATGTGAACGCCAAAATCCGCTGCAACTTAT
TGGACTTACTTAAGGCAGTAAGTGAACCCGCGGACGTCTCTGAATTTGAACCACCTGCACCTGTTGTGCAAGTCAGTCGACTGGAAGCAGAATTTGCGCC
GAGATCAAGCCGACCACCAACCTTTAGCCGGCAGGATCGACGCGCAGAAGAGGAACTTGATCGATGGCTGGAAGATCCTGTCGACATTGCACGAAAAGAG
GACTACACACCAAATGAATCAGTACTTGAGTTTTGGCAAAGACTTGAGCACCAAGGCGACTACCGTATCATACCGAAAGCTGTGAGAGTGCTGTTCTCAA
TACCAGTATCTTCGTGCCAGATTGAGCGTGATTTTGGTGTAAGCGGGCAGATGGTAACTACACAGCGCACGACATTAGCCGAGCACAACATCGATATGTG
CTCATTCCTGAACAGAAACAGCGACTTCGTTGATTTATTGCAGTGTGAGGAGATCCCAAAGGGACAGCATCACTTGCACACACCTACAAGCTTCATCTTC
CCCGTCGCTGAAGAAATGGACTATGACCTGGACGAGATGACAAGCGACCTTCTGGCCGACTTCGCTTCTAGTATGTCACTACCTGACGACTTCGAGGAAA
CGAAATCGGAATTGTG
	
	
TGACAGAGCCACCTTCTGTGGTCCTCCAAGCAGTGAAAGAGTTCCAGGCCCTTGGACCCTTCGAGTTGGTGCCTCCACGACCAAAGGAGACTTCGTACAT
ATTCAAGTGGGGGGTTCGTGTCAAGTACATCGAGAACGAGAAGGAGGTCTTCGCGTGGGCTTGTTTGGCCGACGAGGCGTGTCGGACGTCAGGAAAAAAC
CTGTTCAAGCTCTATGCTGGCAAAACGACCATGGCCGTGAAGCACCTCCAGAAGATACACAACGTTGGCTCGCCGAAAACAAAGATAGCGACCGTCAAGA
AGCGCAAACACGACCATGATTACAACCACCTGTCATCGTCCGCCCTGTACTCAAACAACCCAACCCGGCTAAACGTGCTGATGACCACTCTCATGATCAT
CAACCATAACTTGACGTTTCGTATGGTGGAGTACGAAGAGGCAAGACTAATCCAAGCGCTACTCTATAAGGACGAGATGAAGGCCAAGATAACTACAAAG
CAGGTGAAGGAATCTATCGTGGAGCTGTATTCTTCAACACGCAAGGAGATCACTAACTACCTCCAAGAGAACCGAGAGGACTACCCGAACTTTACGCTCG
TGGCAGATTTTTGGACTTGCAAAACAACGCAAGACAAATTTCTTGGGTTGCGGGTTTACCTGGTGGACAAGGCCTGGGAGTACAAGTCCATTCTCTTGGG
AACGAGAAAGTTCAACCCCGCATATGGAGATCGTGATGGCGGCATTGTCAAGCCCTTCAAAGGGTGGTTGAAGCACATGCTCGAGGACTTTGGCTTAGCG
ACGAGCGATTTCTACGGGGCTACGAGCGACTCGGGGGTGACAAACAGCGACTTCGTTGATTTATTGCAGTGTGAGGAGATCCCAAAGGGACAGCATCACT
TGCACACACCTACAAGCTTCATCTTCCCCGTCGCTGAAGAAATGGACTATGACCTGGACGAGATGACAAGCGACCTTCTGGCCGACTTCGCTTCTAGTAT
GTCACTACCTGACGACTTCGAGGAAACGAAATCGGAATTGTGA
	
	
_QSHLLWSSKQ_KSSRPLDPSSWCLHDQRRLRTYSSGGFVSSTSRTRRRSSRGLVWPTRRVGRQEKTCSSSMLAKRPWP_STSRRYTTLARRKQR_RPSR
SANTTMITTTCHRPPCTQTTQPG_TC__PLS_SSTIT_RFVWWSTKRQD_SKRYSIRTR_RPR_LQSR_RNLSWSCILQHARRSLTTSKRTERTTRTLRS
WQIFGLAKQRKTNFLGCGFTWWTRPGSTSPFSWERESSTPHMEIVMAALSSPSKGG_STCSRTLA_RRAISTGLRATRG_QTATSLIYCSVRRSQRDSIT
CTHLQASSSPSLKKWTMTWTR_QATFWPTSLLVCHYLTTSRKRNRNC