Scaffold : contig_46
Gene_id : Phyra_g9583
Description : hypothetical protein
ATGAGCGAGCGCGCGGCCGACGGCGCCTCCAAGCCGCCCAAAGAGCCCGCGGCCCAGCTCAGCGTGGACGACGAGATCGCGACCGTCATGACCACGGCGT
CCACCACCAAGAAGAAGGAGGACATGCGCAACGATAGCACGGGCATCACCGTGGGGGACTCGGCCCACACGCTGTCGGACGTGCGTGCTGACGGCTTAAA
AAATCGTCGCAGAAGAAGAACGAGGAGAACTGACTGTTTTTTTTAATTTTATTTTACGATCTTTTCTTTCAGGGCAAAACGATCCACTACTCTGCAGAGC
GGATCATCGGCAATGGCTCGTTCGGCGTCGTGTTCCAAGCTCAGTGGAAGAGACGGGCGAGATCGTCGCCATCAAGAAGGTGCTGCAAGACAAACGCTTC
AAGGTGGGGGAATGTTTTGTTTTAAATGTGTTCTTATTCTTCTACTGACGTTTATTTTAATTTATTATTGCTGTTGTTGTAAGAATCGGGAGCTGCAGAT
CATGCGCCAGCTGCACCACGTGAACATTGTGCAGCTCAAACACTGCTTCTACTGCAACGGAGAGAAACCAGACGAACTGTATCTGAACTTGGTGCTCGAG
TACATCCCCGACACGGTCTACGGCGTCGCCAGGCAGCTTCAGAAGGCCAAGCAGTACATGCCCGTGGTACTGGTCAAGCTCTACATCTACCAGATTTGTC
GCTCGCTGGCGTACATCCACTCCACGGGCATCTGCCATCGCGACATTAAGCCGCAGAACCTGCTGCTGGATCCCAGGTCTCACGTGGTAAAGCTGTGCGA
TTTTGGAAGTGCCAAGGTGCTGCAGAAGAATGAGCCCAATGTGTCGTACATTTGCTCGCGCTACTACCGAGCCCCAGAGCTCATTTTCGGCGCCACGGAT
TACACCACAGCTATCGGTAATTATTGCAGTTCTGTAGCTTAAAAGTGGTTCGTGTGCTGACGTGTTTTTTTTTCAAATTCAGATATCTGGTCACTAGGCT
GCGTGTGTGCGGAGCTGCTTCTGGGACAGCCGTTGTTCCCTGGAGAGAGCGGTGTGGACCAGTTGGTGGAGATCATTAAAGTTCTGGGCACGCCGCAGCG
TGAGGAGATCGAGGCTATGAACCCGAACTACACGGAGTTCCAATTCCCGCAGATTAAGGCCCACTCCTGGAGCAAGATTTTTCGTTCACGAACCCCTCCC
GAGGCTATTAATTTGCTGTCCAAAATGCTGGTCTACGACCCGAAGCGGTGAGACGTCGGAGTCTGATTGGGTACCTCTGTGGGCTCCACGGCTGACTCGC
TGTGTTGTGTGCGTGTGTGAAAACTAGACGTGTGAAACCGCTGGAAGCTGCAGCGCACCCGTTCTTCGATGAGTTGCGGCACAAGGATCTGAAGCTGCCA
AATGACGTCCCCGCGCCTGCACTGTTCAATTTCACGTTGCAAGGTACGCAAACAATATGCACATGTCTACCTATTACCGAGCCTGTGTAACCCGAGTCCG
TGTTGCTGTCATTTTGCACAGAGCTCTCGCAAGTGGACGCCGCAACGCGCGAGATTTTAGTACCGCTTCACGAGCGGAACTCCACCAACTGGCCGGTCTT
AGAGGACGGCACGTGGCCTGATGCGGCAGCTCACGGGACTTCCTGAAGGGTTGTTGTACATCAAGCAAAACATGAACGGCCCAAGGAGACAGCAATGGAT
TTGACCGAGGGAGAAACCAAATGTATTTTGCTTGTATCTTTAGTGGGCCCGGAGCTGTTACACGATTGATGGCTGTGGTTGTACAGTACCTACTAATTCC
GCACATTGGTGCAACCGTCCTGGTATCGCACGGGTGAAGGCACAGGTGATACATTTTGCAGGCCACGATCTCATAAGGTAAGGATGTTCGTGGTGGAACT
ATCACTGCTGACAACCTCGCGAATGCTAGTGAGCGGGTGCACTGCTGTCTGCCCAAGCAGTGTGCCTCAGGCCCATGGCGAAACCCTGCCGATGTGTGAA
GCCGTCGATTTCGAGTTGCTGCGGCACCTCAAGTCAGCAGTGCCCCAGCAGCGGAATCATGAGAGGCGAAAGGAAAGCTTACCTCCGTTCTGAGCTGCCC
CGTGGAAGGAGTCGGAGCCTGCTGCTGATCTGCTACTGTTGCTGAGTCCCAGCGAAGTTTGAGGTCGGACTCGCTCTTTCTCGGCTGCTTTGGCTTGCTG
GAAGTGCTCCTCCCACTCCTTTTTCGTGTTCTTGATGTCCTGCGTGGAATTTGGACGCCAATTTGTTAGTGGATGGTCAAGTCTCTCCCGCGTACTGTAG
ACCACGACACAGAAGCGTACATTTCGAATGAGCTCGAGTGAGACCTCATTCTGCAGAATAAGCTCTGTCAGCTCCACATCAATCAGCGCGGATTCATCGA
GTAGCTATGGCACATGTTCGTGAGGATCGTTCGCAAGATATCAGTGGAGGCTGCAAATCACCAGTATGACACTTACCTCTGAATGAGCTAACCGCTGGGG
GGCTGTCATGACGTCGTTTTGGTTTTTCGTCACAGTTGCTTCCTCCCCGCCTGGCGGTATTCGAGGAGATTCATGCATTAAGCGATTCTTCGGTCTCCTG
AGTTTGACGAAGCAGCATTTCTCTCAGCCGTGTGTTTTCCCTCTGCAGACTTGCATTGTGTTGCTGCAAGTGCACAAGACTCGGTGTTATCGCTCTTCGA
TGCCAGCTTGCCTTTTCTGACAGTACGAACCTCTAAAGATTTAACCCGCTTTGTTTCAAGCACACGAGTTGCGCTGGGGTCGCTTTCAAATACGGCCAAT
CGCTTCTTTAGGTCCTGAACCTGTTCCTGGAGAATGGGGATGTTGTTGTTCTCCGTCTGAAGGTGCTTGTTTTCCTCCAGCAACGATTGACTAACGGCAT
CAAGCTGATGTTCTTACACGTCGCCAGCGTTTCCTATCATTGTGAACGGACCCAACAGAAGGAGCAATAAGCAAACACGCTGGCCGACCGGAAGCACAGA
CACGTAAGTGCTTACCATCAATACTTCGATGTGCTTCAGCAGTTTTCGGATCGTTGTGTTGGGGTCTGACGGGTCTACACCAAGATGTGAAGTCGAAACA
CTGGGAGACAAGCTCAGTTTCTTTAAATCCCCCAAGATCGTGGATTCTGCGAGGCATCAGCAGCAGCCTCCACCTCTCTCCCTGACAACGGGTTAGCACT
GCGCATTTTATCGACAAAATTGGATGTTGTCGGAGAAGTATCGGTGTCAACGTCCTCGTCACTCGAAAGTTTGGCGTTGGCGTGGTTGGCGGCGGCCTCC
ACTTCCACTGTCGACATTTCACCAGCATCTTCGGCCATGTATTCCAACAAAATCGGATGATTGTTGAGAAAGTCATCGCGGAACAGGCGGACATTACCTC
GAGGCATGAGATTGCTCGCAAAAGGATCGGTTCCATTCGACTTGAAGCTCGCTGCGGTAAGGCTTCCACGAGACCCGGCGCCAGCAGGAGCTGTATATGG
CCGAGCTCCGATAAACCCGTTGTTTCCCTCTCGTGAGCTCTTGTGCACCGAGGCAAAGAACTCTTCGGTCAAGTCTTTATCAAGTTGCGTGACCTTGTCC
CCGTCTAACATCTTGAGGCGCGAAAGTACTCGCACTACCCGGAATTTGTAGCCTTCAACATCTCTTGAGCAGGGATTGCCACCCAAGTCCAATGCGCGCA
GCTACCATACAGAAACATTTAACACGCAATTTCGTTCAGTCTCGAATAGCACGCAGCAAACAATAAGGGGGTCATATTTGAAGCAAACCTTTGGCAGACC
TCGACACGTATGCAAGGCGAATCAAGGTCAGCTATCTGGTTTCCGTAGACAGACACTGTATTGAGCTCGAGCAGCTTGCGCAGAGGGCTAATGTCCACGA
TCTGTGAAGCATTACCATAGGTTCAGCCGGGCGCCCAAGTAATCTACAAACTACCACCTCAGCGCACAATCAACCTGGTTGTTGGCAAGGAATAATTTTT
CAAGCCCCGCACACTGGAGGTTATCGAGCGTCTCGATCTGATTGAAGTTCACATTGAGCTGCTCAAAACAAAAAAGCACCGCGTCAATTGCAACACCAAT
CTTGATCCCCTGACACTGGACTAGACCTCAATCAAGTTGACAAAGTGCTGGAAGTGCTCGAGTGACGCTAGTCGGTTGTGTGATAACGACAGTATCTCTA
GCGATGCCAAACTTTGCGCGCAAGTGTCATCCATATGTGCCACGTCTTCATCACGCAGAATCAACTAGAAGCATTGGCACAACACAAAACAGTTAGGTCT
CAGCTAAAAGGAGGGAACTGCTCACAAAACTCGTCACCTCCTTCAGCGCCAGAAGATCGTAGACCCCCGCGCGATTCATAACCACATCAGTCGTCAGTGT
TATCGCGCTGGAAGCCTCCACTGGCGGCCCCTGGTTAACCTCCATGGCGCAACTCCAGCGCTCGCAGCGACTGGAGATTACGACGCTTCAAGTTCCCCTT
GTGTAGCCACTTCAACTACGAAACGAATGCAAAAATGTAGCCATCTTATTTATTTTCAAGCGTGGCATCTCAGCAATGCAGTACAGGCGGGATGAAGTGC
CGGTTATTCGTCGCCCGAGCTCCCTCTCAGCTCTCGGTGAAGGTGTTGTGGGCTCAGGCGGACAGAGTAATCGACATGGCAAGTGCAAGGTGTCGTGGTA
TCGGTAAGTCTCCCACCAACTTGTGGCACGTGATGCTAGCGCTTCCAGGGGCTAATGCACGTTCATACAACCAGAAATTCCTTCGGAGACACTGTGCCGT
TGCCAGAGATGCCGCCTGAGCCATTGGCACTGGATCCGCCGATGGTGATCCCCCCAGATCTTCGACCTCTGGGCAGCAAGCGGCGATACCTGCGCACAAT
GCAGCTCCTCGCAGACCCTCTACCAGAGGATGACATGAACCGGAACGTGAGGGTAAGCTTACAGAAACTTCGCCGCCACGTCCGATCGGCCGATTGCTGC
GGCACCAAAACTCCATGTCGTCCAAGCGGCTACTCTCGAGCAAGAAAGAACGGAAACTTCTCAAGTCTGTGTCGCACAAGGACCTGGTGCTCGATCGCCA
GGTTTCGAGGCGGATAAAATCAAGCAACTACGTGGAAGAGAAGGAGGCAGAAATTGCAGACGCAGAAAGACAACATGTTCCAGCCACAGATGCAAGCGAA
GACACCATAGCGGCGGAGGCAGAATCATCCTCGGATACACGGTCGCTGGGCAACGTTCATCAGTACGTCTGATGCAGCGATCGAGTTGTGCATGCGTACC
TTACTTAGCCAAGCACCTTTCTCTGACGATCTTGTGGTTCTGTACTTTGTAGAGTCCTGTGACCAGTGCTGCAAAAGAACCACGTAAAGTTCATGGCGAG
CTTGATGGAGAAAATGCAACGGCAAGAGCTCTGCGTCTGCGCCGGATATCCAAGGAGGAGACTCTAGACATCCAAAGCAGTCAAGGGTACTTCGGAAAAA
CCGCGAAGCAGCAATTCTACGCACAGTACAAGCAGCTTTACTCCCGACCGTACCTGTTCATGGACAGTAGAATTGCAAATGGTGCGGCAGGTATACCCGA
CATGAAATCGTTAGCAGAGAGAGGTAGTGCACGTGAATATTTGGACGATACCGCTGAGAGCTCGATCATTCCGGCGTACCCGTCATCAATCGAGATGCGG
AAGATTAGTGAAGAGCTCAATCCATCATCAAGACTCGTGTCCAGAGTATCGTCGTCAATTATCATGGAGGACCGGCCAAAGCTACCCCTACGAGACAAGC
TATCGCCTCGAGCACACTTCTTGGCCTCATGCGCTGCGAAATCCCAAGTGGTAGTTCCCTTTCTCATCCGCAACAGGAACACCAAGGTTTTCGACTTCTC
GTTTCAATCGCTCGGGGATGCCTCCATCTCGGCATTTGCCAAGTCGCTCGTGCACGACCTGCCTCACGTGGAAGAAATCAGCGTGCGAGACAACCGACTA
ACGGACGATGGACTGAACGAACTGCTGCAGGCCGTGAGTGACGACAGCTCAACACTGAATCTCCGTTGTCTTGACATTTCCCAGAACCAAATAGGCCCCA
AGAGCGCACAGACATTACAATTGTATCTAGTGTCGCCACGATGTACCGTAGAAATGCTGCACGTGGACAACGCCGACATCGACGATCACGAATGCGCAGC
CTTCATGACAGCCTTCGAGAAAAACCAGTCTATCAAGAGACTCTGGATGAGCAGGAACTGCATCGGAAAAGCTGAGAACCTCAATGTCGTGCAGCCCGAC
TTCACGACCGGTGGCGAGGCCATTGCCCAAATGCTACACGTGAACACTGTGCTCGTTCATCTGGACCTCTCATGGAATTATTTACGACTCGAAAGCAGCA
TTGCCCTCGCAAACTCGATCCGCGACAATGGTACTCTCATAGAGCTGAAGCTCGCGTATAACGCATGTGCAGATGCCGGTGCTATGATGTTTGGCGAGGC
GTTGCGCTTTAACAAGACTCTGCAGGTGCTGGATTTGTCGTACAACAGCATCGGAGTGAAAGGTGCCATGGTGCTGGGAAATGCCATCCGCTCAAACCGC
GCCCTGCGTTCACTTCAGCTGAACGGGAACAACATCGGACGAGAGGGTGGTCAATTGCTGATGGCAGCACTTTGCGCGAATCAAACCGAGGTTGGATGCA
CTATCGAGCTGCACGCTTGCAATCTAGGAGCCAACATCATGCCGATTGGTGCAGCAGCTCCTGTGCTTCCCAAACCTTCTGCTGGGATCTCGGATCCTCG
TGGCCTTGCACCACATGCAAGCACTAATGGGGAATTCAACGTGCAGGACCTTCCGGTGTTTAATGCAAAGTCCACTCGGGTGTTCAATCCAAGAGAGCCC
GCTGGCAGATATTCACTCAACTACGCAACGCCTATGACAAGATGATCGCGATGGAGCTCGTTCGGCTTGCTACAACACGAAAAGGATGCCGCTTCTTGCG
AATTGAATACAAGACTCCGACGTCGTCAAAGCGGCCTATTACCCTCATCAAGAAGGAGAATCTCGTGGTTGAACAGCACAAAGGCGCAGGGGCTCACCGT
AGCGCAGAGAGCAACGGAGAAGAAACCACGCTTGAGACCAGAGGGCTAGACGCGCTATTCGCCAACGTAGACCGTGACAAGTCCGGGTACATTGACCAGG
ACGAGCTCATGGCGGTTCTCAATCAAATCGGTCTCTTCCCCCGGATGGAGAGCCTGGAGTCCATGCTGCAGAAGTTCGACTACAACAAGTCGGGCTTCAT
CGACGAGGGCGAGTTCAGTGCGTTCTTCTTCCATGCAGTCTTCCAGATGATCGACGAAGACCAGTCCGGCAAAATCGACGCGGACGAAGTCGAGGAAGCG
TTTAAGATGCTGGGCATCCACAAGTACGACGAGAACGAAATCGCCAACGCTATCACCACGTACGACATAAGCGGGGACGGCGAGATGGAGGAGTACGAGT
TTGTAGAGTTCATGAAGAGCAAACTGCTGGAGCGGATCAAGAACAAGCTGCTTGGTTACGATGGAGGTGAAGATGATACCGGAGACCAGGATAGGGTCCC
GCTTGTATCACTGCTGGATGCGTCGACCCAGAAGCCGTGGATAATCCCCGAAGACGGCCAACTAGAGGTCGACTTCCTCTATGACCGCGAGGCGTTTGCG
ACGAACGATGAGGCCTACCGACAGGGCAAAATCTCTCGGGTAGGTCTGGAACTCCTGATCCGAAACATCACTGAAGTCGCTACGTCCAAGTCTGAACAGG
ACGATCTCTTTCATGTGGCCATGTACGACTCGGAGGTTCGGCTCACGGCAGCGCAGGCGTATCAGGTTCTTGACGCTTGCCACTACCTCAAGCCTGAAAG
CAAGAAGATCGAGACGATCGCACTGCTGCTGCCACAAATGCTGACGGCTAAGGAAGCGCAGATCCTCGTAGCTCGAACCTTGACGCTCATGCAGCGGTGT
CGTCTGAAGGCTCGTATGGGCAGTGCGTACTCCGTCGTGCTCGGGAACCCGACGTCTCACTACTCGTTCGATCTCGCCAAGCACAAAGACCGCATCGCGT
TGACCAAGCTGGCTGAAGTTGCTCAGAGCGAGAAGCTCTTCTCGAAATCGCGCTCTGGCCGTGCCGACACGTCGCAGCACGGCAATTGGGAAAACTTTCG
CAACGAAGAGCTCGACGGCCGCAGTATCGTGCTCACCAACACCTTCTTCCACTCACTACCACGACGTGGCAAACTCTGCTTTGACTACGTGAGCACACGC
GTCCCAAGCGAGGCACCACGCAGATCAGTGAACGACGCTTTGACCAGCTCATTGAAATTCTCCAGATGGATGTCGTGCTGCCGGACGCGTTAGGTGCTCT
AGGCCCCACGCGATCTCAACGTGCAAGAGGACACCGTCAACCCAAGGCTGATGTAAGTGAGTCCAAAGCCGAAAAGGAGGAGAGCGAACAAGTGGCTGAG
CTAGCAGGGCCTCTTGCAGCCAAGTTGAAGCGTACAGCCTCCCAGGAGCAGTCTGCGTTCTGGAACAAGACGCGCGCCTCGATCCTCAAGCGCGGCTGGG
ACTTTGTCGTGAACCACGCGTACACGTTCCGCCTCACGGGCGCCACCAAGGAGAACGTGGGGCTCAAGATGGTGCAGATCGAGTCGGCCATTTGCGACCG
GTGGCTCTCTTGCGACCAGGCCTCCAAGATCATCGCGTGCATGCCGGCGACCTTCCACGCGCGGCCGGAGACGGCCCGCATCCTCTTCTCTCGGCTCATC
GACCTGCACAACTTCCACCGCATCTACGACGCCATGCCCAGGTCAGAGCAGCAGGTCTGCGCCAGTACGCTGGGCTGGCTCAACATGATGAACCCCATGG
CGCCCGAGCGCTTCTACGCGCTCAACTTGGCCGTGTACGACGAGCGCGAGATGACCAAAGTGCTGGTGGACTTGGCCATTGGCGAGCCGGGCGAGAACTG
GCTTAACCAGAACTTCACGCTCGTGCAGGGCGAGCCGGGCATCCCCGGCTGGAAGCTGCCCGCTCGCTGGGAGAAAGAGGACAACAAGGAGGGCGGCGTG
AACCGCGCGGGCTTCCTCGAGCTCGAGTACTATTCCGGCCAGGACCGCGGCTGCGCGCCCGTGGTCTCGCTGCGCAAGACGCTCATGAAGCGCGTGCTGT
GCGGCACCCGCCTGTACTGCCTCT
	
	
ATGAGCGAGCGCGCGGCCGACGGCGCCTCCAAGCCGCCCAAAGAGCCCGCGGCCCAGCTCAGCGTGGACGACGAGATCGCGACCGTCATGACCACGGCGT
CCACCACCAAGAAGAAGGAGGACATGCGCAACGATAGCACGGGCATCACCGTGGGGGACTCGGCCCACACGCTGTCGGACATCATGCGCCAGCTGCACCA
CGTGAACATTGTGCAGCTCAAACACTGCTTCTACTGCAACGGAGAGAAACCAGACGAACTGTATCTGAACTTGGTGCTCGAGTACATCCCCGACACGGTC
TACGGCGTCGCCAGGCAGCTTCAGAAGGCCAAGCAGTACATGCCCGTGGTACTGGTCAAGCTCTACATCTACCAGATTTGTCGCTCGCTGGCGTACATCC
ACTCCACGGGCATCTGCCATCGCGACATTAAGCCGCAGAACCTGCTGCTGGATCCCAGGTCTCACGTGGTAAAGCTGTGCGATTTTGGAAGTGCCAAGGT
GCTGCAGAAGAATGAGCCCAATGTGTCGTACATTTGCTCGCGCTACTACCGAGCCCCAGAGCTCATTTTCGGCGCCACGGATTACACCACAGCTATCGAT
ATCTGGTCACTAGGCTGCGTGTGTGCGGAGCTGCTTCTGGGACAGCCGTTGTTCCCTGGAGAGAGCGGTGTGGACCAGTTGGTGGAGATCATTAAAGTTC
TGGGCACGCCGCAGCGTGAGGAGATCGAGGCTATGAACCCGAACTACACGGAGTTCCAATTCCCGCAGATTAAGGCCCACTCCTGGAGCAAGATTTTTCG
TTCACGAACCCCTCCCGAGGCTATTAATTTGCTGTCCAAAATGCTGGTCTACGACCCGAAGCGGAACACCAAGGTTTTCGACTTCTCGTTTCAATCGCTC
GGGGATGCCTCCATCTCGGCATTTGCCAAGTCGCTCGTGCACGACCTGCCTCACGTGGAAGAAATCAGCGTGCGAGACAACCGACTAACGGACGATGGAC
TGAACGAACTGCTGCAGGCCGTGAGTGACGACAGCTCAACACTGAATCTCCGTTGTCTTGACATTTCCCAGAACCAAATAGGCCCCAAGAGCGCACAGAC
ATTACAATTGTATCTAGTGTCGCCACGATGTACCGTAGAAATGCTGCACGTGGACAACGCCGACATCGACGATCACGAATGCGCAGCCTTCATGACAGCC
TTCGAGAAAAACCAGTCTATCAAGAGACTCTGGATGAGCAGGAACTGCATCGGAAAAGCTGAGAACCTCAATGTCGTGCAGCCCGACTTCACGACCGGTG
GCGAGGCCATTGCCCAAATGCTACACGTGAACACTGTGCTCGTTCATCTGGACCTCTCATGGAATTATTTACGACTCGAAAGCAGCATTGCCCTCGCAAA
CTCGATCCGCGACAATGGTACTCTCATAGAGCTGAAGCTCGCGTATAACGCATGTGCAGATGCCGGTGCTATGATGTTTGGCGAGGCGTTGCGCTTTAAC
AAGACTCTGCAGGTGCTGGATTTGTCGTACAACAGCATCGGAGTGAAAGGTGCCATGCGGCCTATTACCCTCATCAAGAAGGAGAATCTCGTGGTTGAAC
AGCACAAAGGCGCAGGGGCTCACCGTAGCGCAGAGAGCAACGGAGAAGAAACCACGCTTGAGACCAGAGGGCTAGACGCGCTATTCGCCAACGTAGACCG
TGACAAGTCCGGGTACATTGACCAGGACGAGCTCATGGCGGTTCTCAATCAAATCGGTCTCTTCCCCCGGATGGAGAGCCTGGAGTCCATGCTGCAGAAG
TTCGACTACAACAAGTCGGGCTTCATCGACGAGGGCGAGTTCAGTGCGTTCTTCTTCCATGCAGTCTTCCAGATGATCGACGAAGACCAGTCCGGCAAAA
TCGACGCGGACGAAGTCGAGGAAGCGTTTAAGATGCTGGGCATCCACAAGTACGACGAGAACGAAATCGCCAACGCTATCACCACGTACGACATAAGCGG
GGACGGCGAGATGGAGGAGTACGAGTTTGTAGAGTTCATGAAGAGCAAACTGCTGGAGCGGATCAAGAACAAGCTGCTTGGTTACGATGGAGGTGAAGAT
GATACCGGAGACCAGGATAGGGTCCCGCTTGTATCACTGCTGGATGCGTCGACCCAGAAGCCGTGGATAATCCCCGAAGACGGCCAACTAGAGGTCGACT
TCCTCTATGACCGCGAGGCGTTTGCGACGAACGATGAGGCCTACCGACAGGGCAAAATCTCTCGGGTAGGTCTGGAACTCCTGATCCGAAACATCACTGA
AGTCGCTACGTCCAAGTCTGAACAGGACGATCTCTTTCATGTGGCCATGTACGACTCGGAGGTTCGGCTCACGGCAGCGCAGGCGTATCAGGTTCTTGAC
GCTTGCCACTACCTCAAGCCTGAAAGCAAGAAGATCGAGACGATCGCACTGCTGCTGCCACAAATGCTGACGGCTAAGGAAGCGCAGATCCTCGTAGCTC
GAACCTTGACGCTCATGCAGCGGTGTCGTCTGAAGGCTCGTATGGGCAGTGCGTACTCCGTCGTGCTCGGGAACCCGACGTCTCACTACTCGTTCGATCT
CGCCAAGCACAAAGACCGCATCGCGTTGACCAAGCTGGCTGAAGTTGCTCAGAGCGAGAAGCTCTTCTCGAAATCGCGCTCTGGCCGTGCCGACACGTCG
CAGCACGGCAATTGGGAAAACTTTCGCAACGAAGAGCTCGACGGCCGCAGTATCGTGCTCACCAACACCTTCTTCCACTCACTACCACGACGCACCACGC
AGATCAGTGAACGACGCTTTGACCAGCTCATTGAAATTCTCCAGATGGATGTCGTGCTGCCGGACGCGTTAGGTGCTCTAGGCCCCACGCGATCTCAACG
TGCAAGAGGACACCGTCAACCCAAGGCTGATGTAAGTGAGTCCAAAGCCGAAAAGGAGGAGAGCGAACAAGTGGCTGAGCTAGCAGGGCCTCTTGCAGCC
AAGTTGAAGCGTACAGCCTCCCAGGAGCAGTCTGCGTTCTGGAACAAGACGCGCGCCTCGATCCTCAAGCGCGGCTGGGACTTTGTCGTGAACCACGCGT
ACACGTTCCGCCTCACGGGCGCCACCAAGGAGAACGTGGGGCTCAAGATGGTGCAGATCGAGTCGGCCATTTGCGACCGGTGGCTCTCTTGCGACCAGGC
CTCCAAGATCATCGCGTGCATGCCGGCGACCTTCCACGCGCGGCCGGAGACGGCCCGCATCCTCTTCTCTCGGCTCATCGACCTGCACAACTTCCACCGC
ATCTACGACGCCATGCCCAGGTCAGAGCAGCAGGTCTGCGCCAGTACGCTGGGCTGGCTCAACATGATGAACCCCATGGCGCCCGAGCGCTTCTACGCGC
TCAACTTGGCCGTGTACGACGAGCGCGAGATGACCAAAGTGCTGGTGGACTTGGCCATTGGCGAGCCGGGCGAGAACTGGCTTAACCAGAACTTCACGCT
CGTGCAGGGCGAGCCGGGCATCCCCGGCTGGAAGCTGCCCGCTCGCTGGGAGAAAGAGGACAACAAGGAGGGCGGCGTGAACCGCGCGGGCTTCCTCGAG
CTCGAGTACTATTCCGGCCAGGACCGCGGCTGCGCGCCCGTGGTCTCGCTGCGCAAGACGCTCATGAAGCGCGTGCTGTGCGGCACCCGCCTGTACTGCC
TCTA
	
	
MSERAADGASKPPKEPAAQLSVDDEIATVMTTASTTKKKEDMRNDSTGITVGDSAHTLSDIMRQLHHVNIVQLKHCFYCNGEKPDELYLNLVLEYIPDTV
YGVARQLQKAKQYMPVVLVKLYIYQICRSLAYIHSTGICHRDIKPQNLLLDPRSHVVKLCDFGSAKVLQKNEPNVSYICSRYYRAPELIFGATDYTTAID
IWSLGCVCAELLLGQPLFPGESGVDQLVEIIKVLGTPQREEIEAMNPNYTEFQFPQIKAHSWSKIFRSRTPPEAINLLSKMLVYDPKRNTKVFDFSFQSL
GDASISAFAKSLVHDLPHVEEISVRDNRLTDDGLNELLQAVSDDSSTLNLRCLDISQNQIGPKSAQTLQLYLVSPRCTVEMLHVDNADIDDHECAAFMTA
FEKNQSIKRLWMSRNCIGKAENLNVVQPDFTTGGEAIAQMLHVNTVLVHLDLSWNYLRLESSIALANSIRDNGTLIELKLAYNACADAGAMMFGEALRFN
KTLQVLDLSYNSIGVKGAMRPITLIKKENLVVEQHKGAGAHRSAESNGEETTLETRGLDALFANVDRDKSGYIDQDELMAVLNQIGLFPRMESLESMLQK
FDYNKSGFIDEGEFSAFFFHAVFQMIDEDQSGKIDADEVEEAFKMLGIHKYDENEIANAITTYDISGDGEMEEYEFVEFMKSKLLERIKNKLLGYDGGED
DTGDQDRVPLVSLLDASTQKPWIIPEDGQLEVDFLYDREAFATNDEAYRQGKISRVGLELLIRNITEVATSKSEQDDLFHVAMYDSEVRLTAAQAYQVLD
ACHYLKPESKKIETIALLLPQMLTAKEAQILVARTLTLMQRCRLKARMGSAYSVVLGNPTSHYSFDLAKHKDRIALTKLAEVAQSEKLFSKSRSGRADTS
QHGNWENFRNEELDGRSIVLTNTFFHSLPRRTTQISERRFDQLIEILQMDVVLPDALGALGPTRSQRARGHRQPKADVSESKAEKEESEQVAELAGPLAA
KLKRTASQEQSAFWNKTRASILKRGWDFVVNHAYTFRLTGATKENVGLKMVQIESAICDRWLSCDQASKIIACMPATFHARPETARILFSRLIDLHNFHR
IYDAMPRSEQQVCASTLGWLNMMNPMAPERFYALNLAVYDEREMTKVLVDLAIGEPGENWLNQNFTLVQGEPGIPGWKLPARWEKEDNKEGGVNRAGFLE
LEYYSGQDRGCAPVVSLRKTLMKRVLCGTRLYCL