Scaffold : contig_16
Gene_id : Phyra_g4182
Description : hypothetical protein
TGTCGCTCCCAGTCACAAGCTGGAAGCGTTTCGCTCGCGAACTGCACGATGGACGCATCGAGCAGATCTGCATCCTCTCGGACGTCGAGAGGATGACGTG
TGAAGCAGAAGAGCTGAATCAGCTCATCGCTGAGGGCGTTCGCGCCCTCGAAGAAGGAGCGCTTCGACGAGCAAGGCTGGGACTCGCTCAAGGCGAGCCC
CTTTTACAAGGTCTTGCGTGAGTACAAGGATGTACTCCCGGACGACATTCCTGCGGAGTTACCGCAGGACAAGGGTGTTCAGCACGAGATTGATCTCGTG
CCGGGAACGAAGTACTGCGTCACGCGACAGTGGCCACTGCCGCGTGAGCAAGTCAAGGCAATCGACGACTTCTTTGAAAGTCGTCGCAATGCAGGACAAG
TGCGGGAATCGAAGTCCCCGCACAGCGCGCCTACGTTCTGTGTGAAGAAACCACAGGGCGGGTGGCGCATCGTTCATGCGTACAACAAGCTGAACGATGC
GACGGTACCGGCGCAGACGCCGATACCTCGAAAAGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGTACTCTGGATCTGAGAGACGGGTTC
TATCAGATCCTCATGCGTGAGAGTGATATCCCTCTCACAGCGGTAAGCACTCCGAGCGGCATGCTCTGGGAGTGGCTCGTGATGCCGCAGGGGCTGAAGA
ACGCCCCAGCGACGTTCAACAGGTGCGTCACGCACTTGTTGCGCTCGGTGCGCGACTTCGCACCGAGCTATTTCGACGACGTGTTCATTCACAGCCGGGC
TGTGAATGGGAAATCGGATGTGGAGATGCATACAGAGCATCTCCGCAAGTTGCTTGAGCTCATGCGAAAGCACAAGCTCTACGCGAACCTGAAGAAGTGT
ATCTTCGGGGCGACCGAGATACCCGTACTTGGGTGTCTCGTGGGGAAGAACGGCGTACGCCCTGACCCAGGAAAGGTCAGAGTGATCAATGAATGGCCTA
CGCCTTCAAACGTAAAGGAACTGCGGCAGTTCCTTGGACTCGCCACGTACTTGTGCAAGTACGTGAGCAACTACGCGGGCAAGATTCGCCCGCTGTCGCA
GCTCTTAAAGAAAGAGGCTGCATGGGAATGGACTGCTGATTGTCAGCAGGCCTTCGAAGCAGTCAAGCAGGGCTTGACTGAGGCGCCGATCTTGGCGGTG
GCCGACCAAGATCGCCCATTCCACGTTGTGTGCGATGCATCCGATTTCGCGATCGGATGCGCACTGATGCAACTCGATCACGAAGGTCGTGATCGTGTGG
TTTACTACCAATCGCGTCAGCTGAAGCCAGCTGAGCGCAATTACCCGGTACATGACAAGGAACTCCTTGCCATGAAGTATGCACTCGCAAAGTTTCGAGT
GTATCTACTTGGGAGTAGACCATTCGTGGTCTACACCGACCACGCATCGTTGCGTACGGCGATCAAGTCGCCGCACATATCACAAAGAATGGCACGGTGG
CTGTCATTCTTTGCTGAATACAACTTCCAGGTTGAGTACAAACCTGGAAGGTTGAATGTCGTGGCCGACGCGCTTTCGCGTCGACCAGATTATGCGGTGC
AAGAGGCCGACGCCAACGCAGTTGGCGTCGTCAGGACGACTACACCCTCGTCGTCCTTGTTGGATGACGTGAAGGCCGCATACGCACATGATGCGGATGC
GAAGCAATTGTTGGAGTACTTCTCCACACCTTCTGACAAGTCTCGTCAGAAGCTGGCCAAACACCTTCGTGCCCGTGTACACCGTTATCGTGTACGCAAT
GGTCTGCTGCTTTACAGCGCAGTCGACGACAACGCAGATCGCATTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTATGAGTACCACGATG
CCCCGACATCGGGACATCCTGGCCGTGAGAAGACATATTTGCTTCTCACGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAAGTACGTTCG
TGCTTGCGAGGTATGCCAGCGCGTGAAGCCTGCGCCCAACTCGCAGGCTCCGCTTCAATCACTACCGACTCCGTCGGAGTGCTGGCAGTCCATTTCAATG
GACTTTGTTTTTGGTCTTCCGCAAGACAACAAGCGGAGGACTGGTATTGTGGTCTTTGTTGACCGCTTCAGCAAGATGGTGCATCTTGCTGCAGTACCAG
CCGAGGTGACAGCCAAACAGACGGCATGTCTGTTTGTCGACATGGTGTTTAGACACCATGGTATGCCACTCGACATCGTGTCGGATCGGGATCCGCGCTT
TACAGCGCGATTCTGGCAAGAAGTGTTTACACTTCTTGGGACGCAGTTGTCCATGTCGACTGCGGATCACCCGCAGACCGACGGACAAACAGAGCGTGTC
AACCGCGTGCTGGTTGACACCATGAAGAGCTACGCGCACTCGTTCCATCAATGGAGCGACTGCTTGCCGATGGCGGAGTTCGCCATCAACAACTCGGTGC
ATGTCTCGACAGGACACACACCGTTCTACGTGAATGCCATGAGGCACCCACGCGTACCGAGCGTACTCGGTGCGGTAGCTCCTTCCTTAAGTGGGGGAGG
ATATCCGGTTAATTCAAAACAACCGGATAAGCACGCTGATGCGAGCAATGTATCAGCTGTGACGATTTACTGCGCGCAGTCATGGCAACGACAACACAGT
GTCTACGACGGGCGTAGACACTTTAAACGACAACGAACATCACGCGCAGGCCGGGCCTGCTGCGAACAAGGAGCACGAACTGAACCAGGGGTTCAGCTCG
GATGCAATGGACTTTGTCCAGCGTCGACAAGCCGTAATTCGGTTTGTCCAAGATGCAATAGCAGCTTCTGTCGATCGACAGAAGCTGAATGCCGATAACA
CGGCAGGGAAACACAAATGAATTCAAAGTTGGTTCATTAGTTCTGTTAGCTACGCAGAACCTAGCTAAACATGCAGTTTCCGATTTCGGAGCAAGCAAGC
TTGCTCCGCGCTTCATTGGGCCATTCACCGTGTTGGCGAAGCATGGCAACGCGTACACACTGGACATACCGTCCAGCATGCGCTTGCACCCAACGTTTTA
CGTTGGGCGACTGAAGCCGTACGTGCAGCACGAGTCACCTACGTCTGGTGACTCGCCAAAGCGCTCTCGAGCGCGGCGACGCGCTTCGAACGCCAGAGAG
CTCGTCCCGACCTCGACCTTTACGTTCGAGGTCGTCTGCGCAACCTCCGCGAGCTGAGCCTTTAACAAGCTCAGCTCCTGACGCAGAGCAGCGAACTGCG
ACGCTTGGAGACGCTCAACAGCCTCCAAGCGAGACTCAAGGTTGGTTGACCAAACCCGGGGCGTCTTCCCCCCCCCCCCACCCCCCGTTGCGAGACGCAC
GCGGGGCAACTCGCTGGATCGTCCAGCGAATTGTTGGTCATCGGAACCAGACCCGAGGTCCGGTTCATTTTCGTATTCGTTGGAGAGGATTTCCTCCCCA
ACACGATACGTGGGAATCACGGAATGTCCTGATGGAGGACATTCCGGAAATGGTGACGGCGTACGAAGGCCGCCACCGCCACCTCCGCCGAAGGGCGTAA
AACTTGGGCGAGCGCTGTAGTCGCCTACAGCACTCGGATAAGTGCTGCGATTATCCGCAGCACTAGAAGACGCCTGCGCCTGAAAACTGGCGCGCAGGGT
CTTGAGGTCGTCAGGTACACACATGGACGTGTACCCGTTGACGTCCCGCTCGGTGATGCGTACTGCTCCGGGTAGCAGTACTCACAAGCAGTGTCATAAG
GCACTGCGCAAGGAAGTCCAATACCGACTGCACCATGGTGCAGTCGTTCAAGTTTACCACGCTTCGAGAACTTCTCGTAGCGCTCCCGCGCCTGGCTAAT
CCGGTCGCGATAGCCAGCGGGGTTCTTGTTGAAGTTTTCAACAAAGGCACTCCAACTTTGACAAAGTGCCTGCCACTCGGGCACTTTGCTTCTGCGAGAA
GTCTTCTTGCTCGCAAACCATCGGAGCTCATGGAAGAGCCCGATGTAGTAGTCGCGCCTTTGATTCGTTAACGGATCAAAGTGTACTCGCTTCGCGACGT
CATCGTCAACGATGGCGTTGCACGAGTACAGCGCGTACAGATTCGGTGGCGCGGTCGCACCGAATCGGCTGCCGATCTCAGACTGAGACGGCATCCACGG
CTCGCGCACTGGCTCAGTGCGCGAGGCCGCAACAACAGCGGATGGAGCAGAGTCATCTCCATCCCGCGGAGTCGTCAAGGCTCCAGCGGCAGCGAGCGGT
GTTCCACTGCCGCTGCGCGAACGCTTCGAGCTCGAAGCGTTCGGGTCGTCCTCGCGTGGACGACGCAGACCCACATTGGGGTCAGTGTGGCCCGGAGACA
AGGTTCCTTGTCTCCTTCGAGTTCCCCTCCTCGACTTCGCTTCCGTAGTCGAGGGGAACTCCCTCTCCACCCGGAGAGTAGATGCCCACTCCGGTTTCGA
CAGCAATGATCTTGCCTGTCTTGTTTCGGATGGCATGTTTCTCATGCCATCTCGAGTGGTATCCAGCAACAGAGAGGCGACTCTCTGTTGCCGCGCTTGT
CGGCATCGCCGTCGAGGCGATGCCAGAAGCGGTCGTGGCTGAGGCAGCGGCCGTCGTCGCCCTGGAGACGACGACAGCACTTGCTGTTGCCGAAGCGGCC
GGCGTCTTGGACGAAGACGTCGTTGGCGTGCTCATTCCCAATGAGCACGTGTTCTCCCGAAGAAAATACGGATTGACGTGTCGAGACCGGCACGTCAAAT
CCTAACGGGGGGATGGTGTAGCGGGGCTACACATTCGGTTCACCTCCTACCTTAGTGCAACATGCACTAAGGCAACATTCAGGTGACCACCACAGGGTGG
TCCACATTCATAGCAAAAGGCATATGACTGGTAGAAAGTAACACCTTTCTACCAATGAGAGTCATTCAATAGATATGGGGTTTGGCCAGCCATCCAATGG
TAGAACCTCTCATTAGAAATATCAGTTTTAGGAGGAAACCCCATTTACAATCAATACAGTTCTCATTTGGCACCAAAGCTATCGTTCGGTCCATTTATCT
AGGTTTATGTATACTTGCGGATACAAGTATACTGAACTTAAGTAAATTACTCCTACGCTTCCTCATACACGTGCGCACACGTGTAAGCTTAAGTAGTGGG
TCTAAGCAGACCCATTACAGTCGGGTCTGGGCACGTACTAGACCGGAGTCGCCACGACCGACTCGGAGCTATGCTCCTTAGACACACGGTCGGCTCGATG
GTGCAGCCGGTTATCAGCTGCTACCACAGGCCGAGGTGTCAGCATTGCTGACCCTTGTATGCCGAAGCGCAAGCTGCGCTTGTGTTCCGAAGAACCCAGT
GTTTAAATTCGCGGCACGAGCCACATGGTTGACGTCGTGCCTGGCGCAATGTATATCGTGCCCGGTCGTCCAGACCTTAACTGAAGAGGAAGACGCGGGT
TACTTGGGTAACATAGTTCCACACACCATTCACGGAAGAGGTGGGCCCATGGTGGCTTCACCCGACGTGGGTAACATCGTTCCCACGTCAAGTCGCACAG
ACTCAAACTGTTCCCGGGCTGGACGAATTCCAGCCGCGGTTGACTCGGTCACCCCGGAGGGGATCGATCGTAAGAGGGGGAGGGGCTCGGAAATACCTCT
CCTCCCAAGTCTCTAGAGAGACTAGCTTCCTCACGGAAGCTGTTGTTGGCATGAGCCAACAACTGTACAGCATCAGTGCTGCACGCTTGCGGCACTTGAG
GCAGCCGTGGTACATTGAGCACAGCCCCGTACGCCGACGCGGTCACATGTGGTGATGAGTGCCGTGCATGCTTGCACGCACTCGGAACATCTCAATGTTC
TAGTGGTAGCCGTAGTACACGGCGAACCACTGACGTATGGGCTCACAGGCCCGTACGCCATCGTGGTCTTGGAAAAGACCGAGTGTCGTGCAGGCTTGCA
CACACTCCGACCGTGCCCTGGTCTTGGCGATGCACGAAGCAATCGCCGGCACCAGAGTGAAGGTGGTAGAGAGTGCATGTAGCTCCCACCATGCTTCAAG
TACCGATAGGTACCTCGGTGGTGATGTCCGACATCGAAGCGTCTATGGTACGACGACCTAGACGCGGGGGTGGAGCTTGATGCTCTACCCGAAATGCTCT
TAGTGATGAGCAGGCTGCTAATGGCAGCCGTCGTATCACTACGACGAAGCACGATGCTTAGTGCTTTGGTCAACGAATGACCTGAGCGCGTGTACGGCGT
CGATGCTTCACGCGCTCAGCCATGACTAGCGTGGCCCATGCGGGTCCGCTATCATGACAGGAGGTGAGCTGCGAGCTCCCTCCACTCTTGGGCTATGTGA
TGCCCGGGATGGTGTCGACCCACACGGGAGACACAACACACACGAAGGTCAGGGAGGGCCCACGGCTCCTCCCAACTGAACTGCAGGTAGTCAAGGAGAA
CCACCGCAAGTTTGGATGCAGTAGCATCCCGTGCCGAAGCACTGAGCGCTTGCTAGCGCTGCAACGCGAGTTGCTAAGGACGTCGGCTTCGCGGCCGACA
TTGTCCTTTGTGCAAGGAAGCACCTCGCAGTGTCCGCCACGGACACAAGTCACTGCGTGACTGTCGAGAGGGCGCGCCAGCCGTGCTGTGGCTGCGCCCG
GGAATTCCCAATTTGGGAGTTCCAATTCTCTCCCTTCTGATTGGAGAATAAGGTGTGATTCTCAGATAAGTGGGGGAGGATGTAACGGGGTACACTGAAG
TGTACCCGTGTTACCTAAAGAGTGACGGGACGTCTCTCTTTTGTGCCCATGGTACGTGGTACCGGTTGGCGGTGAGCCAACCATTGGGCACTTGTTTAGC
TTTTACTATAGTTGACTTAGAGTTTGTAAGGATCAAGCTTGGCTCACCTATAAAAATATATTCAGTCTTTAAACCTACCGTCTAAGTCGTAGTCGGTTCC
CTTAGTCGGGGGAACCGTGAACTTGTTGTTCACCGAGAGCTTACGCTCTCTAGCACTTCCTCTGTGCAAGGTGCTGTGTGCCCCGTCACACTTGGTAGCA
CTTGTAGTCAATCCACGCCTACGCGGGTAGGATTGGACTACCTGAATCCTCTGTGGTCTCAAAGCCTGAGCCACTATGGAACGAAGTGAGTTTCCTCACT
TGAACGACTCGCAGTTCGAGCCCGTTCGAAAGATGGGAGGCATCTTTGGGAGGGATGTCTTCCGAGGCTTGGCGTCGGTGATGCCAGCGGAGCAAGTCGA
ACGCGTGAACGCGTTCGACACGTATGAGCGTGAGCTCATTGCTCACGTGCAGGGAAACCTGCAGGCCTCTGTGGCCGAGCCGAAGCCGGTCCAGCCGAAG
CGTTTGCGGCTGGCTGTGCCTGCGTTCGAAGGGAAGGAAGGTGAAAACCTTCACTTCTGGATCCGAGAAGTTGAGATCGCCATGAGGGCGGGTCTCATCT
CGGATCAGGGACTTCGCGTTGCGTTCGCGTTGTCCAACCTAAGCGGTCGTGCCAAGAATTGGGCGTACACGCTGGAGACGACGTCTCCTGGATGCTTTGC
ATCCTGGGAACAGTTGTGCGAGCGGCTTCGCGCTGCTTTTCTCCCGGCGAACGATGCGTTCCGCCAGCGCTCCCGCTTCCTCGCCTGTAAGCAAGGGAAG
CGCGAGCTGTACGAGTACGTACAAGAGATGCGCACGTTGGCATCATCGTTGGTGGGGAACCAATTTCCACACGTGGAAGTTCAAGATGCAGGTGGTGCTC
GAGGAGCGCGAACTGTGGGAAGTGACGAGTGGGGAAGTGAAGCTGGAGCACTGCATGACCACGGCGGATCAAGCGACGTTCAAGAGGAAGTCGCGTAAGG
CGCTGGCGATCATCTGTCTCGCGATGGAGGACTCGCAGCTGCCGCTGGTTCGCTCGGCCAAGGACGCGCATGATGCATGGTCAAGACTGGAAGGACACTT
CGAGAAGAAGAGTTTGGCCAACAAGCTCTTTCTTCGTCGGCGTTTCTTCACGACGATGATGGACGAAGGTGATGATGTGCTGGAGCACATCAGCAAGCTC
AAGACGCTGGCGGAGCAGCTCGACGCGGTTGGCGCTCCGGTCAGCGAGGACGACTTGGTGATCACGCTTCTGGGCAGTCTGAGCGAGTCGTACCAGTTCC
TGATCACGGCGTTGGAGTCGAGAGCCGACTCGCTGTCGTGGGAACTCGTGACATCTCGGCTGCTGCATGAGGACATGAAGCGCAAGGAACAAGGTGGCAG
CGGCGTCGACGGAGCCGCGC
	
	
TGTCGCTCCCAGTCACAAGCTGGAAGCGTTTCGCTCGCGAACTGCACGATGGACGCATCGAGCAGATCTGCATCCTCTCGGACGTCGAGAGGATGACGTG
CTGGGACTCGCTCAAGGCGAGCCCCTTTTACAAGGTCTTGCGTGAGTACAAGGATGTACTCCCGGACGACATTCCTGCGGAGTTACCGCAGGACAAGGGT
GTTCAGCACGAGATTGATCTCGTGCCGGGAACGAAGTACTGCGTCACGCGACAGTGGCCACTGCCGCGTGAGCAAGTCAAGGCAATCGACGACTTCTTTG
AAAGTCGTCGCAATGCAGGACAAGTGCGGGAATCGAAGTCCCCGCACAGCGCGCCTACGTTCTGTGTGAAGAAACCACAGGGCGGGTGGCGCATCGTTCA
TGCGTACAACAAGCTGAACGATGCGACGGTACCGGCGCAGACGCCGATACCTCGAAAAGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGT
ACTCTGGATCTGAGAGACGGGTTCTATCAGATCCTCATGCGTGAGAGTGATATCCCTCTCACAGCGGTAAGCACTCCGAGCGGCATGCTCTGGGAGTGGC
TCGTGATGCCGCAGGGGCTGAAGAACGCCCCAGCGACGTTCAACAGGTGCGTCACGCACTTGTTGCGCTCGGTGCGCGACTTCGCACCGAGCTATTTCGA
CGACGTGTTCATTCACAGCCGGGCTGTGAATGGGAAATCGGATGTGGAGATGCATACAGAGCATCTCCGCAAGTTGCTTGAGCTCATGCGAAAGCACAAG
CTCTACGCGAACCTGAAGAAGTGTATCTTCGGGGCGACCGAGATACCCGTACTTGGGTGTCTCGTGGGGAAGAACGGCGAACTGCGGCAGTTCCTTGGAC
TCGCCACGTACTTGTGCAAGTACGTGAGCAACTACGCGGGCAAGATTCGCCCGCTGTCGCAGCTCTTAAAGAAAGAGGCTGCATGGGAATGGACTGCTGA
TTTCGACGACAACGCAGATCGCATTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTATGAGTACCACGATGCCCCGACATCGGGACATCCT
GGCCGTGAGAAGACATATTTGCTTCTCACGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAATCATGGCAACGACAACACAGTGTCTACGA
CGGGCGTAGACACTTTAAACGACAACGAACATCACGCGCAGGCCGGGCCTGCTGCGAACAAGGAGCACGAACTGAACCAGGGGTTCAGCTCGGATGCAAT
GGACTTTGTCCAGCCCACTATGGAACGAAGTGAGTTTCCTCACTTGAACGACTCGCAGTTCGAGCCCGTTCGAAAGATGGGAGGCATCTTTGGGAGGGAT
GTCTTCCGAGGCTTGGCGTCGGTGATGCCAGCGGAGCAAGTCGAACGCGTGAACGCGTTCGACACGTATGAGCGTGAGCTCATTGCTCACGTGCAGGGAA
ACCTGCAGGCCTCTGTGGCCGAGCCGAAGCCGGTCCAGCCGAAGCGTTTGCGGCTGGCTGTGCCTGCGTTCGAAGGGAAGGAAGGTGAAAACCTTCACTT
CTGGATCCGAGAAGTTGAGATCGCCATGAGGGCGGGTCTCATCTCGGATCAGGGACTTCGCGTTGCGTTCGCGTTGTCCAACCTAAGCGGTCGTGCCAAG
AATTGGGCGTACACGCTGGAGACGACGTCTCCTGGATGCTTTGCATCCTGGGAACAGTTGTGCGAGCGGCTTCGCGCTGCTTTTCTCCCGGCGAACGATG
CGTTCCGCCAGCGCTCCCGCTTCCTCGCCTGTAAGCAAGGGAAGCGCGAGCTGTACGAGTACGTACAAGAGATGCGCACGTTGGCATCATCGTTGGAGCG
CGAACTGTGGGAAGTGACGAGTGGGGAAGTGAAGCTGGAGCACTGCATGACCACGGCGGATCAAGCGACGTTCAAGAGGAAGTCGCGTAAGGCGCTGGCG
ATCATCTGTCTCGCGATGGAGGACTCGCAGCTGCCGCTGGTTCGCTCGGCCAAGGACGCGCATGATGCATGGTCAAGACTGGAAGGACACTTCGAGAAGA
AGAGTTTGGCCAACAAGCTCTTTCTTCGTCGGCGTTTCTTCACGACGATGATGGACGAAGGTGATGATGTGCTGGAGCACATCAGCAAGCTCAAGACGCT
GGCGGAGCAGCTCGACGCGGTTGGCGCTCCGGTCAGCGAGGACGACTTGGTGATCACGCTTCTGGGCAGTCTGAGCGAGTCGTACCAGTTCCTGATCACG
GCGTTGGAGTCGAGAGCCGACTCGCTGTCGTGGGAACTCGTGACATCTCGGCTGCTGCATGAGGACATGAAGCGCAAGGAACAAGGTGGCAGCGGCGTCG
ACGGAGCCGCGCA
	
	
CRSQSQAGSVSLANCTMDASSRSASSRTSRG_RAGTRSRRAPFTRSCVSTRMYSRTTFLRSYRRTRVFSTRLISCRERSTASRDSGHCRVSKSRQSTTSL
KVVAMQDKCGNRSPRTARLRSV_RNHRAGGASFMRTTS_TMRRYRRRRRYLEKM_SSIR_PRVLSSVLWI_ETGSIRSSCVRVISLSQR_ALRAACSGSG
S_CRRG_RTPQRRSTGASRTCCARCATSHRAISTTCSFTAGL_MGNRMWRCIQSISASCLSSCESTSSTRT_RSVSSGRPRYPYLGVSWGRTANCGSSLD
SPRTCAST_ATTRARFARCRSS_RKRLHGNGLLISTTTQIALSCRMIMS_SSRSRMSTTMPRHRDILAVRRHICFSRVTSIGVTSTSGYAIMATTTQCLR
RA_TL_TTTNITRRPGLLRTRSTN_TRGSARMQWTLSSPLWNEVSFLT_TTRSSSPFERWEASLGGMSSEAWRR_CQRSKSNA_TRSTRMSVSSLLTCRE
TCRPLWPSRSRSSRSVCGWLCLRSKGRKVKTFTSGSEKLRSP_GRVSSRIRDFALRSRCPT_AVVPRIGRTRWRRRLLDALHPGNSCASGFALLFSRRTM
RSASAPASSPVSKGSASCTSTYKRCARWHHRWSANCGK_RVGK_SWSTA_PRRIKRRSRGSRVRRWRSSVSRWRTRSCRWFARPRTRMMHGQDWKDTSRR
RVWPTSSFFVGVSSRR_WTKVMMCWSTSASSRRWRSSSTRLALRSARTTW_SRFWAV_ASRTSS_SRRWSREPTRCRGNS_HLGCCMRT_SARNKVAAAS
TEPR