Scaffold : Scaffold_1
Gene_id : Phypl_g26
Description : hypothetical protein PITG_03758
atgctggaggaagGCGCATCTGTCATCCTGACTCGCGTGGAGAATGCGAcggagcttctcggccgtCAACAAGTGTCGACGGAGGATATTGCGGCCCTAA
ACCAAGTCTTAGAGGGGCTTCAACACATTGTTGCAGGTTTCGGCTCCCAGCGGGTCCTGGAGCTGTCGGGTACGCGGATGATGAACGCTGGTGTGGAACT
GTACAAcgcgccgcgagctgctctcAGGGTTCTCGCGCAagtggagaaggccaagcagcaaggTGACGGTCAGCCGACGAGGTTCCCACGGTATGCGCTG
GCAGTCACGCGGTTCGTAGCAGCGAAGATCATGGGGCTGTCTCTGGTTTGCTCCAAAGACGGTGGGGTCCAGGAGAAGGGCGGGAAGAAGAACTTGCAGT
TCATGGACGAGTgcgtcgacgtgctgcgctcgtTTGGTCGAGTGGGCATGCTCATGATGGAGAGCGCGTCGATTGACTGTGAAAGGTGTGAGGAATactt
ggcgctggcgaaggaatcattttcttcttcaatgCAGCTGTGGTCTCGCATCGGGCTCTCTCATCTAGCGAAGTTCAAGCAAggcttggagctggaggac
gttGTGGACGATTTGTGGGATTTCTGCGTGGACCGAGTACGAGTGCTTCGCTTGCTGGCAGAGCGTTCTGACAATTCATCAGAAGAATTTCGAGATATTG
TATCATCCCTACATGAGTTGAAGATGCTGGCTCCATACAAGACTTCGTATGCAAGCAGTTTGCTTGATGTTATGAAGAGTGTGAGCGATGGATACCGCCG
TGCGgcccaccacgagctgcaaaTGGCAttcgcagaagaagcgctgcGTGTCGGCGACTCGCTTGAAAATGATGCCGACGAAAACTTTCCGGGGTTGATT
ACGTCGTTTAAGCAGCACGTGTTAGTGAATTTACTGCAGGCACTCTGCACTTCTGGAGATATTGAACGAGCTGAAACGTGCTACCAGCTGATTCCAGCCA
ACCAAGACTCCAAAGTATTGCTGCTCATGAACAAGCTCTTCGTTGACAGCAAGCAATTTGAGAAAGCGCATCGCTTGCTTCAACTATTGTTTCAGCAGGA
TTGCTTCGACGACTCTATCATAGGAGCCCGCACCTTTGCGCAAGGATTATCCTTCTCCGACAAAGGCTTGGATATTTATCGAGAGCTTGCCGACAGTTAT
GGGGATGCCGACTTCGCCATCAATTTGGATGTCGCATGCAACCTCGCTTTTGTCGAGGGCAAGCAATACGAAGCTatggacgagctcaagcgcattGGAT
GTGCTTTGCTAGAAGACGAGCGGTATGAGTCCACGAATACTCGGAAAGGTATGGCTGTCTCATTTTACAGTGTATGCTACAGGGGTGACCAAGCAGTAGA
TACCAGACACATTCTACGGGTTCGACAGACCATTTTTGACGCTCTTCAGCACACGCTGAATTCTAACCAGCACGAGGTAAGTTGCTCAAATATCAGGGGT
ATTGTACAAGGGCAATATTCACTCGTTTGTGATATCATAGGACTGCTTGAAGTGGGCTGATGCTGGTTTGGCTACCGTTTCAACACCACGAGAAAAAGCG
ATGTACAAGAGGTAACCAACCGTGGCTTTAGCTGTACTATTATACAAATAATTTGACCCCAATGATACTCTGCAGGATCATGTCTCGCTCGTTCCTCCAG
CTGGGCCGTGATGCTGAAGCTTTACATTGGGCTGAAAAGGCTTTTGCTACAGAGCCTTCCAAGCAATCTCTGCTTGCTGTGTTCCAAGTAGCACTTGAAG
CAAAACCTGAAGTCTCAGAGGAAGAATTGGTGCGAATCATGGAGAAGTTAAAAGCTAGAGATGACTTTGAGATTGAAGATTTACTCGCAATGGGAAAGCT
AGCCAGCAATCTTGGTTCATCGAGACAAGATGTTTTGCTGCACATTCTGGATGAGCTGTGCCATATTCTCGGTCAAACCGACGGCAATCCAACAAAGGTT
CCTGTGGCTGTAGTGCTACAAAATGCCGCGCAACTGGCCTTTAGCAACTtcactcagcagcaacaagccgGAGATAATTCAGAAAATTTCTACGGCGAGA
AATTCCTGACGTACGCGAACGCGCTActgttgaagttgtcggaAGCCGACACAATCGATCATAAAGAAAGTTTCGGGCCTGCTTCGGTCTTCGAGTGGTT
CTTTCGGATGAGGTAGGAGCTCGCGATTGTCTTCACACATTTTTTGCGGACTCTGATAAATGCTACTCGATCTTTGTGACAGCTTTGACATCGCCAAAAG
CACCGAAGACTCCACATATTTTATCGTGGCAGCCAATATAGCAGAACGGAGCAACGAATTATACGCGGAAAACTCCCCACTCTTGCAGCGATACCAGCAA
TGTTTGGTGGCTGCAGTAAGCTCCAACATGAAGAAAATCGAGACATTGGATAAGAGCCAACTCCACGGGCTTCTCGAAGTGATCAGCCGGATCGGATGCT
TTGAGAGTGGAGATAcagctgttgctgccgaaGTCATGTGCTACTTGGTACGGAACGCCTTATACTGCAGCAAAGAGCAGTGATTTTCACCAAATTGATT
TCTTGTTGATAGGCGAGGGCAGTGATAGCGGTGAAATTGAGACTCTTAGACGCAAATACAAAGGCGATTCTTGATCTTTGCAAGGCGACACAGCACAGGG
CTCCTGAGCTCATGGAGATTGGAGGTAGGTCATACCCAGATAACAACCATAGCTTCGTGATTTCACTCATGTTTGTCCTACCCTGCAGAGTTAGTGCTGT
ACGCGACGAGATTCAACGAAGCGTCCGAGGTAAGTCTTGTTCGGACTGGCATTACaaatgccccccccccctcagTTGGTTTACTTGAGTAGGTTCGAGA
CAGCTATCGATCTTTAGCCGGAGAAATATTCAGCTACGGGTACGACCTATAAACCATTGACGGCACGCACTCATTTGCACTAAAAGAATATCGAAAAATG
TAAAGAATACAAATGCTGGTCCAAGAGGGATCGATAGACTCGAGCAAGCTGTGCTATCTGCTACGACGAGTTATCACGCTGGCGGAATCGAAGCCAAAAG
CACACGAGTGGTTCGAGCAACTACTTCAGGTCATTGACAATTTGGACCTAACGATTTCGGAGTCCGACATGGAGTGGTTTGTCGCGAAGGCGTGGAACAT
TGTGCGTACCTTCGACTTCTATGAAGATCCAAAATGTCTCTACTAACCGAAGCACATTTTAGGGAGTGCTCTGCCATCGAGGGAATAATACTGAAGAAGC
TCTCCAGTTCATGAAAACTGCTCAGGTTATAATGCGTAAGTGGCATACATGACCCTTCTCGCCATTTAGAGAACTCACCCATGTCTTTTGGTTGTGTAGA
TCACAGTGAGCAGCTCATGGAAAAGCTAGGCGATGGACTCGATCAGCAGTACCAGGAGATTCTCAGAATGAGCGTCAACTCGGCACTCAACGGCTA
	
	
atgctggaggaagGCGCATCTGTCATCCTGACTCGCGTGGAGAATGCGAcggagcttctcggccgtCAACAAGTGTCGACGGAGGATATTGCGGCCCTAA
ACCAAGTCTTAGAGGGGCTTCAACACATTGTTGCAGGTTTCGGCTCCCAGCGGGTCCTGGAGCTGTCGGGTACGCGGATGATGAACGCTGGTGTGGAACT
GTACAAcgcgccgcgagctgctctcAGGGTTCTCGCGCAagtggagaaggccaagcagcaaggTGACGGTCAGCCGACGAGGTTCCCACGGTATGCGCTG
GCAGTCACGCGGTTCGTAGCAGCGAAGATCATGGGGCTGTCTCTGGTTTGCTCCAAAGACGGTGGGGTCCAGGAGAAGGGCGGGAAGAAGAACTTGCAGT
TCATGGACGAGTgcgtcgacgtgctgcgctcgtTTGGTCGAGTGGGCATGCTCATGATGGAGAGCGCGTCGATTGACTGTGAAAGGTGTGAGGAATactt
ggcgctggcgaaggaatcattttcttcttcaatgCAGCTGTGGTCTCGCATCGGGCTCTCTCATCTAGCGAAGTTCAAGCAAggcttggagctggaggac
gttGTGGACGATTTGTGGGATTTCTGCGTGGACCGAGTACGAGTGCTTCGCTTGCTGGCAGAGCGTTCTGACAATTCATCAGAAGAATTTCGAGATATTG
TATCATCCCTACATGAGTTGAAGATGCTGGCTCCATACAAGACTTCGTATGCAAGCAGTTTGCTTGATGTTATGAAGAGTGTGAGCGATGGATACCGCCG
TGCGgcccaccacgagctgcaaaTGGCAttcgcagaagaagcgctgcGTGTCGGCGACTCGCTTGAAAATGATGCCGACGAAAACTTTCCGGGGTTGATT
ACGTCGTTTAAGCAGCACGTGTTAGTGAATTTACTGCAGGCACTCTGCACTTCTGGAGATATTGAACGAGCTGAAACGTGCTACCAGCTGATTCCAGCCA
ACCAAGACTCCAAAGTATTGCTGCTCATGAACAAGCTCTTCGTTGACAGCAAGCAATTTGAGAAAGCGCATCGCTTGCTTCAACTATTGTTTCAGCAGGA
TTGCTTCGACGACTCTATCATAGGAGCCCGCACCTTTGCGCAAGGATTATCCTTCTCCGACAAAGGCTTGGATATTTATCGAGAGCTTGCCGACAGTTAT
GGGGATGCCGACTTCGCCATCAATTTGGATGTCGCATGCAACCTCGCTTTTGTCGAGGGCAAGCAATACGAAGCTatggacgagctcaagcgcattGGAT
GTGCTTTGCTAGAAGACGAGCGGATCATGTCTCGCTCGTTCCTCCAGCTGGGCCGTGATGCTGAAGCTTTACATTGGGCTGAAAAGGCTTTTGCTACAGA
GCCTTCCAAGCAATCTCTGCTTGCTGTGTTCCAAGTAGCACTTGAAGCAAAACCTGAAGTCTCAGAGGAAGAATTGGTGCGAATCATGGAGAAGTTAAAA
GCTAGAGATGACTTTGAGATTGAAGATTTACTCGCAATGGGAAAGCTAGCCAGCAATCTTGGTTCATCGAGACAAGATGTTTTGCTGCACATTCTGGATG
AGCTGTGCCATATTCTCGGTCAAACCGACGGCAATCCAACAAAGGTTCCTGTGGCTGTAGTGCTACAAAATGCCGCGCAACTGGCCTTTAGCAACTtcac
tcagcagcaacaagccgGAGATAATTCAGAAAATTTCTACGGCGAGAAATTCCTGACGTACGCGAACGCGCTActgttgaagttgtcggaAGCCGACACA
ATCGATCATAAAGAAAGTTTCGGGCCTGCTTCGGTCTTCGAGTGGTTCTTTCGGATGAGAGTTAGTGCTGTACGCGACGAGATTCAACGAAGCGTCCGAG
TTATCACGCTGGCGGAATCGAAGCCAAAAGCACACGAGTGGTTCGAGCAACTACTTCAGGTCATTGACAATTTGGACCTAACGATTTCGGAGTCCGACAT
GGAGTGGTTTGTCGCGAAGGCGTGGAACATTGTGCATCACAGTGAGCAGCTCATGGAAAAGCTAGGCGATGGACTCGATCAGCAGTACCAGGAGATTCTC
AGAATGAGCGTCAACTCGGCACTCAACGGCTAA
	
	
MLEEGASVILTRVENATELLGRQQVSTEDIAALNQVLEGLQHIVAGFGSQRVLELSGTRMMNAGVELYNAPRAALRVLAQVEKAKQQGDGQPTRFPRYAL
AVTRFVAAKIMGLSLVCSKDGGVQEKGGKKNLQFMDECVDVLRSFGRVGMLMMESASIDCERCEEYLALAKESFSSSMQLWSRIGLSHLAKFKQGLELED
VVDDLWDFCVDRVRVLRLLAERSDNSSEEFRDIVSSLHELKMLAPYKTSYASSLLDVMKSVSDGYRRAAHHELQMAFAEEALRVGDSLENDADENFPGLI
TSFKQHVLVNLLQALCTSGDIERAETCYQLIPANQDSKVLLLMNKLFVDSKQFEKAHRLLQLLFQQDCFDDSIIGARTFAQGLSFSDKGLDIYRELADSY
GDADFAINLDVACNLAFVEGKQYEAMDELKRIGCALLEDERIMSRSFLQLGRDAEALHWAEKAFATEPSKQSLLAVFQVALEAKPEVSEEELVRIMEKLK
ARDDFEIEDLLAMGKLASNLGSSRQDVLLHILDELCHILGQTDGNPTKVPVAVVLQNAAQLAFSNFTQQQQAGDNSENFYGEKFLTYANALLLKLSEADT
IDHKESFGPASVFEWFFRMRVSAVRDEIQRSVRVITLAESKPKAHEWFEQLLQVIDNLDLTISESDMEWFVAKAWNIVHHSEQLMEKLGDGLDQQYQEIL
RMSVNSALNG_