Scaffold : Scaffold_1
Gene_id : Phypl_g47
Description : hypothetical protein PHYSODRAFT_552331
ATGATGCAGACGATCGCCAAGCGCTCGGCCTCCGCGGCCAGGGCCAACGCGCGCCGCGCCTTCTCGAACGCGGCTGCCGCCGAGGCCGGCAAGGACCGCC
TCGTGATCTTCGACACCACGCTGCGCGACGGTGAGCAGTCGCCCGGCGCCACGCTCAacttcaaggagaagctggacatCGCGCGCGGCCTGagcgcgct
gggcgtggacgtgtGCGAGGCGGGCTTCCCCATCTCGTCGCCCGGCGACTTCAACGCCGTGTCGGCCATCGCCAAGGAGATCGGCCCGATCACGGCGAAC
CGCCCCTCTGGCGTGCCCATGACCATTTGTGGTCTTGCGCGCGCCATGGAGAAGGACATCCAGCGCTGCtacgacgccgtcaagcACGCGCCCAAGCACC
GCATCCACACGTTCCTGGCCACGTCCGACATCCACCTCAAGTACAAGCTCAAGATCTCGCGCGACGAGTGCATCCGTcgcgccgtggacgccgtcaagTT
CGCCAAGAGCCTGACCTCGGACGTTGAGTTCTCCACGGAGGACGCTGGGCGCAGTGATCCCGACTTCCTGTGCGAGGTCCTCGCCGAGGTCATCAAGGCC
GGCGCCACCACGCTCAACGTCCCCGACACGGTCGGCTACACCGTCCCGGGCGAGTACGGATCGCTCTTCCGCTACCTGATCGACAACACGGAGGGCAGCG
ACAAGGCTATCTTCTCCACGCACTGCCACAACGACCTGGGTCTTGCGACGGCCAACACCCTGTCCGCTGTGCAGGGCGGCGCGCGTCAGGTGGAAGTTAC
CATCAACGGTATCGGTGAGCGCGCCGGTAACACGGCtctcgaggagctggtgatGGCTCTGAAGACTCGCCCGCAGCACTTCCCCGTGTACACGAGCGTG
GACTCGACGCAGATCACCCGTTGCAGCCGTATGGTCAGCCACTACACTGGTATGTCTATCCAGCCCAACAAGGCCATTGTGGGATCGAACGCCTTTGCTC
ACGAGTCTGGTATCCACCAGGATGGTGTCTTGAAGCACCAGGCCACGTACGAGATCATGCTGCCTGAGTCGGTTGGTCTCAGCGAGAACAAGATGGTGCT
CGGCAAGCACTCTGGTCGTCACGCGTACAGCaagcgcctccagcagcttggctACGCCAACCTCACCCCGGAGGAGCTCGACTACTACGTGGAGAAGTTC
AAAGTGCTGGCtgacgagaagaagacggtcACGGACGCGGACATGGAGGCGATTGTTTCGGATGAGCTGTTCAAGCCCGAGGTCTTCTGGACCCTGCAGT
CCGTGCACGTCACTGCTGGCAACCTCGTGAAGCCGACGGCCACGGTCACGCTTGCGCACAAGGACGGCCAGGAGGTGAGCGAGGCCGCGATGGGTACTGG
TCCGATTGACGCCATCTACGTGGCCATCAAGCGCGCTACGGGCATGGAGAGCATCAAGCTGAACGACTTCTCCGTGGAGAGTGTGACGGATGGCACGTAC
GCTCTGGGTGAGGTGACCGTGCGGGTgcaggaggacaaggaggaggaggagaagaccgaggacgagaagcacGTGAACGCGCAGACGGGTGTCACGCGTG
ACCGCCAGTTCGTCGGCCATGGTGCTAACACGGATATCCTGGTGGCGTCGGCTACTGCTTACGTGAACGCCGTGAACCGCATGATGGCATCGCAGGcgcg
tgctgttgctgaggCTCGGGTGGACGCCTA
	
	
ATGATGCAGACGATCGCCAAGCGCTCGGCCTCCGCGGCCAGGGCCAACGCGCGCCGCGCCTTCTCGAACGCGGCTGCCGCCGAGGCCGGCAAGGACCGCC
TCGTGATCTTCGACACCACGCTGCGCGACGGTGAGCAGTCGCCCGGCGCCACGCTCAacttcaaggagaagctggacatCGCGCGCGGCCTGagcgcgct
gggcgtggacgtgtGCGAGGCGGGCTTCCCCATCTCGTCGCCCGGCGACTTCAACGCCGTGTCGGCCATCGCCAAGGAGATCGGCCCGATCACGGCGAAC
CGCCCCTCTGGCGTGCCCATGACCATTTGTGGTCTTGCGCGCGCCATGGAGAAGGACATCCAGCGCTGCtacgacgccgtcaagcACGCGCCCAAGCACC
GCATCCACACGTTCCTGGCCACGTCCGACATCCACCTCAAGTACAAGCTCAAGATCTCGCGCGACGAGTGCATCCGTcgcgccgtggacgccgtcaagTT
CGCCAAGAGCCTGACCTCGGACGTTGAGTTCTCCACGGAGGACGCTGGGCGCAGTGATCCCGACTTCCTGTGCGAGGTCCTCGCCGAGGTCATCAAGGCC
GGCGCCACCACGCTCAACGTCCCCGACACGGTCGGCTACACCGTCCCGGGCGAGTACGGATCGCTCTTCCGCTACCTGATCGACAACACGGAGGGCAGCG
ACAAGGCTATCTTCTCCACGCACTGCCACAACGACCTGGGTCTTGCGACGGCCAACACCCTGTCCGCTGTGCAGGGCGGCGCGCGTCAGGTGGAAGTTAC
CATCAACGGTATCGGTGAGCGCGCCGGTAACACGGCtctcgaggagctggtgatGGCTCTGAAGACTCGCCCGCAGCACTTCCCCGTGTACACGAGCGTG
GACTCGACGCAGATCACCCGTTGCAGCCGTATGGTCAGCCACTACACTGGTATGTCTATCCAGCCCAACAAGGCCATTGTGGGATCGAACGCCTTTGCTC
ACGAGTCTGGTATCCACCAGGATGGTGTCTTGAAGCACCAGGCCACGTACGAGATCATGCTGCCTGAGTCGGTTGGTCTCAGCGAGAACAAGATGGTGCT
CGGCAAGCACTCTGGTCGTCACGCGTACAGCaagcgcctccagcagcttggctACGCCAACCTCACCCCGGAGGAGCTCGACTACTACGTGGAGAAGTTC
AAAGTGCTGGCtgacgagaagaagacggtcACGGACGCGGACATGGAGGCGATTGTTTCGGATGAGCTGTTCAAGCCCGAGGTCTTCTGGACCCTGCAGT
CCGTGCACGTCACTGCTGGCAACCTCGTGAAGCCGACGGCCACGGTCACGCTTGCGCACAAGGACGGCCAGGAGGTGAGCGAGGCCGCGATGGGTACTGG
TCCGATTGACGCCATCTACGTGGCCATCAAGCGCGCTACGGGCATGGAGAGCATCAAGCTGAACGACTTCTCCGTGGAGAGTGTGACGGATGGCACGTAC
GCTCTGGGTGAGGTGACCGTGCGGGTgcaggaggacaaggaggaggaggagaagaccgaggacgagaagcacGTGAACGCGCAGACGGGTGTCACGCGTG
ACCGCCAGTTCGTCGGCCATGGTGCTAACACGGATATCCTGGTGGCGTCGGCTACTGCTTACGTGAACGCCGTGAACCGCATGATGGCATCGCAGGcgcg
tgctgttgctgaggCTCGGGTGGACGCCTAA
	
	
MMQTIAKRSASAARANARRAFSNAAAAEAGKDRLVIFDTTLRDGEQSPGATLNFKEKLDIARGLSALGVDVCEAGFPISSPGDFNAVSAIAKEIGPITAN
RPSGVPMTICGLARAMEKDIQRCYDAVKHAPKHRIHTFLATSDIHLKYKLKISRDECIRRAVDAVKFAKSLTSDVEFSTEDAGRSDPDFLCEVLAEVIKA
GATTLNVPDTVGYTVPGEYGSLFRYLIDNTEGSDKAIFSTHCHNDLGLATANTLSAVQGGARQVEVTINGIGERAGNTALEELVMALKTRPQHFPVYTSV
DSTQITRCSRMVSHYTGMSIQPNKAIVGSNAFAHESGIHQDGVLKHQATYEIMLPESVGLSENKMVLGKHSGRHAYSKRLQQLGYANLTPEELDYYVEKF
KVLADEKKTVTDADMEAIVSDELFKPEVFWTLQSVHVTAGNLVKPTATVTLAHKDGQEVSEAAMGTGPIDAIYVAIKRATGMESIKLNDFSVESVTDGTY
ALGEVTVRVQEDKEEEEKTEDEKHVNAQTGVTRDRQFVGHGANTDILVASATAYVNAVNRMMASQARAVAEARVDA_