Scaffold : Scaffold_1
Gene_id : Phypl_g37
Description : hypothetical protein PHYSODRAFT_469149
atgaccaccaccacgcacCCGTTCGAATGGTACGCCGCCTCGCAACCCGTGCTGTGGATGAGCCTGGCGCTTTACTAACTTTGCCTGCATGGCCGGCTCT
CTGCAGCGACATTAGCCTGAGCTTCcccgaggaggtggacgcgcagctcgtgctgcagacgctcgaagtcgacgaggagctgcagcccgagAAGATCCAC
CGCACGCTGACCGTCAAGGGCACGGAGCTCCACGTGTAAGTTTGCCTTCGTCAGCCTTTTGCTGTAGTTGTAGTTGTAGTTGTGGTTGCTTTGCTTTCTA
TGCTGTGGGCTGCAGGTGCTAACGCTCCCAATGTGGTGTCCTCCTGGattggtggcggtggtgcgtTGCAGCCACTTCGAGACCACGGAGATCCGactgc
tgcgcgccgcggTGTCTTCCTTCTACGACATGAGCGCGCTGACCGCCAGGACGCTGTTGGAGTTCAAGGAGTG
	
	
atgaccaccaccacgcacCCGTTCGAATGCGACATTAGCCTGAGCTTCcccgaggaggtggacgcgcagctcgtgctgcagacgctcgaagtcgacgagg
agctgcagcccgagAAGATCCACCGCACGCTGACCGTCAAGGGCACGGAGCTCCACGTCCACTTCGAGACCACGGAGATCCGactgctgcgcgccgcggT
GTCTTCCTTCTACGACATGAGCGCGCTGACCGCCAGGACGCTGTTGGAGTTCAAGGAGTGA
	
	
MTTTTHPFECDISLSFPEEVDAQLVLQTLEVDEELQPEKIHRTLTVKGTELHVHFETTEIRLLRAAVSSFYDMSALTARTLLEFKE_