Scaffold : Scaffold_1
Gene_id : Phypl_g2
Description : hypothetical protein PHYSODRAFT_476538
ATGACAATTTGCTgtcccagcagcagccaagaagtggagtcgccgccgctcaTGGAGAACTCGCGCccggagccgccgcccgccaGGATCTcggccgcgc
agcagcagaagcttcgAGAGGCCTACAGCTCGCCCATGCGCCCGTCGCAGTACACGCGCGCGCCcgaagacggcgtcgacggcgacaaggagacgCCGCg
cgaggccgccgcgcgccgcgagcgcgtgagcatggagcaggtgctgctggaccgccGCTGGGTCTTCCActgcgcgtcgccgctcttccacttccgccgc
gagcagctcagcgagtacGCGCACGACCTggtcaagacgctgcgcgccgcggcgctgcggaCGTGCGGCCAGCAGTTCGGCTACAGCGTGAGCATCCGCA
ACACGGACACGTTCGTGGCCTTCCAGATccgcgaggagcgcgaccGACGCCGCAACAGAGAAGCCAAGACGGACGCGCGTCAGAGAGACGCCCCGGAGCG
AACGGGAGGCTTCGTGCTCTACTTcccgacggaggaggagcagcgcgcgccgcgtAAAGGACGCGAGAGacagcaggtgctgctgctgagggggcacgaa
gagctgctgcactggGTCTGCtcgtggctgcagcgccgcttcCAGTGCGTGGTGGACACTCACGTCGTGCACATCCAGCAGATGAACCTCAAGCGCTTGG
CGCGCAACTGGGCGGTGGCGAGTCTGCTGGCGGAAGGAGCGAGGCCGTCGCGAGTTCTACGCGAGGAGAATaaccaggaagaagaagacgggGGACATCC
TCGCGGCAGCTCCATTATGACCGCCCAAGAACCGCCGCGAACGCCGCTACTGCTCAAGTACCGCGCGACGAAAGAAGCGGACGTCGTGCGCACATACACA
ATGACGGTGCCCTGGGCCACGCTGCGTCGACTCTTCCAGCAGACGAAAGACGGACCTGGAGGCAACCGCCCGTCCAATATCGTGCCAGGTACAGTACGCG
ACGAACTCGGGTGTGCTTATGCTTAGTGCGGCGTTATCTTACTAACGGGGTGATTGTTTTTCAGAGCTcatcgagctggtggagcgaCTCTACATCGATT
CGTTGCCATTTGACCTGTCCACTTACGAGATCGAGCGAGTCGAGATGCAGGAAGTGGCCGTTGACCTCGATGGAGGCGTGGAGGTGAGTCTTTTGTTGAG
TCATTTTGCTGGCTGGATTGTGTTGTCTAAACTCGATGTCTTTACGCTTGTGTAGCTTTACAGCATGGACCTTGTGCACACAGTACTATTCAGCCTGCTG
GAGCTACTGGCAGTGCAGGGTGTTGCCACGGCTTCGCGTccggagacgacgctgtg
	
	
ATGACAATTTGCTgtcccagcagcagccaagaagtggagtcgccgccgctcaTGGAGAACTCGCGCccggagccgccgcccgccaGGATCTcggccgcgc
agcagcagaagcttcgAGAGGCCTACAGCTCGCCCATGCGCCCGTCGCAGTACACGCGCGCGCCcgaagacggcgtcgacggcgacaaggagacgCCGCg
cgaggccgccgcgcgccgcgagcgcgtgagcatggagcaggtgctgctggaccgccGCTGGGTCTTCCActgcgcgtcgccgctcttccacttccgccgc
gagcagctcagcgagtacGCGCACGACCTggtcaagacgctgcgcgccgcggcgctgcggaCGTGCGGCCAGCAGTTCGGCTACAGCGTGAGCATCCGCA
ACACGGACACGTTCGTGGCCTTCCAGATccgcgaggagcgcgaccGACGCCGCAACAGAGAAGCCAAGACGGACGCGCGTCAGAGAGACGCCCCGGAGCG
AACGGGAGGCTTCGTGCTCTACTTcccgacggaggaggagcagcgcgcgccgcgtAAAGGACGCGAGAGacagcaggtgctgctgctgagggggcacgaa
gagctgctgcactggGTCTGCtcgtggctgcagcgccgcttcCAGTGCGTGGTGGACACTCACGTCGTGCACATCCAGCAGATGAACCTCAAGCGCTTGG
CGCGCAACTGGGCGGTGGCGAGTCTGCTGGCGGAAGGAGCGAGGCCGTCGCGAGTTCTACGCGAGGAGAATaaccaggaagaagaagacgggGGACATCC
TCGCGGCAGCTCCATTATGACCGCCCAAGAACCGCCGCGAACGCCGCTACTGCTCAAGTACCGCGCGACGAAAGAAGCGGACGTCGTGCGCACATACACA
ATGACGGTGCCCTGGGCCACGCTGCGTCGACTCTTCCAGCAGACGAAAGACGGACCTGGAGGCAACCGCCCGTCCAATATCGTGCCAGAGCTcatcgagc
tggtggagcgaCTCTACATCGATTCGTTGCCATTTGACCTGTCCACTTACGAGATCGAGCGAGTCGAGATGCAGGAAGTGGCCGTTGACCTCGATGGAGG
CGTGGAGCTTTACAGCATGGACCTTGTGCACACAGTACTATTCAGCCTGCTGGAGCTACTGGCAGTGCAGGGTGTTGCCACGGCTTCGCGTccggagacg
acgctgtgA
	
	
MTICCPSSSQEVESPPLMENSRPEPPPARISAAQQQKLREAYSSPMRPSQYTRAPEDGVDGDKETPREAAARRERVSMEQVLLDRRWVFHCASPLFHFRR
EQLSEYAHDLVKTLRAAALRTCGQQFGYSVSIRNTDTFVAFQIREERDRRRNREAKTDARQRDAPERTGGFVLYFPTEEEQRAPRKGRERQQVLLLRGHE
ELLHWVCSWLQRRFQCVVDTHVVHIQQMNLKRLARNWAVASLLAEGARPSRVLREENNQEEEDGGHPRGSSIMTAQEPPRTPLLLKYRATKEADVVRTYT
MTVPWATLRRLFQQTKDGPGGNRPSNIVPELIELVERLYIDSLPFDLSTYEIERVEMQEVAVDLDGGVELYSMDLVHTVLFSLLELLAVQGVATASRPET
TL_