Scaffold : Scaffold_1
Gene_id : Phypl_g8
Description : hypothetical protein
ATGGCGGCGGATGCGGAAGATGCGGCGCCAAGTATCCGCGTGACCTGCGCAGGCGTGCGCGCGAACCCGCGCAGGTCGCAGCCGGCGGACAACGGGTGCG
TGTTCTTCAGCGAGTCGCAGTACGCTTCGTCCCCTTTCCTCGTGCGCGTGACCTTCGACAGCGTCAGCTTCGTCCACCGCGGGACGCACGTCGTGGAGCG
GCGCTTCGTCTTTCCaggccgcgtgctgcacgctgtGCTGGCGGATTTCTCCCAAGAAACGTTAAATAGTACAGCAACGCCCAAAAATGGGTCCGCGGAG
CGCAGACGAGCGCGGAAAGCGGCGCGAAAGCCTCGTCCGCACCCGCATTTGTGCGTCTTGGTGCGCTCCGACTGCCTAAATGTGTACACCGCAACTGGGG
AGGTCTtcgaggtggcgctgccctTCCAGGCTAATAGACTCTTCCCCGTAGAGGGGTGGGGCTTGCTGCTACAGCGCAGtccggcggcggcggtcccgtc
cacggcgtcgaagcgccctcgagacgctgctgcggtggcgctggccaggaAGAATCGACGTGCGAGCACCAGTAACAGAGGAGACGGAGATAGATACAAG
TACAGTTCAGGGGAGAAGGGGGTGCCGGCGAGACCGAGGTACTTTACGCTCAGGCACCCGCTGGATGAGGTCAAGCCGGTGGCGTTGAGAGCGGTAGGAG
GCGTGACGGGGAAAAGGGAGGAGAAGTTTCTGTCGGActcggcgctggaagctgtggacgtgctggaggaagcaGTGTCCCCCGTTCTGGTGGCATTTCA
TCGATGGGAGCAGAGGTTTTATGTTTTTCGGATGAATGTGGTGGAGAAATTGAAGAGTTGTGTGATGCCGGAGGTGAGAGTGGTGGATGGaccgacgtgg
acgagataCCGTGCTAGAAGCGACTTGGAGGAATTGCGCGTGCGGATTGAGCCGGATTGGATGGCAACGATGCTGTGGAAATCGCCACGTGTTGGGCCAG
CGACTTCGAAGCCGATGTTTCTGTCCCCGATCGTCTCGCCTTCTGTCTTGACTGCTTCACCTGTTCCACCATCGCCGATAACGACCAATACGTCGTCGAC
CTCGTCTGGGAACGTTACCAAGGTGGCATTTATCGTGTCAGGTGTCGATGGTCTTCCATTGTTGTGCATAATGGACAAGGATGCTGGAACTCTGCTTCTG
AAACCCATTTCACAGCAAGAGCCCACTACAGCAATGCTCGACGAAGGAGGCAATGAAATCGGTGGCATTCGTCTCTTGCACTGTCGTGACGCGGTTCCGA
TCAGGCAGCAAGATTACGCAGGATCGCGTGAAGGTGGCAAAGGCCGAGGCTTCGAGGGTTCCACCGATATTGTGGTGCTCGAAAAGGATGGCACGCTCAT
GCTGTATAGAGCGCATCATCCAATTTGCCGCCTGGTTCTTCCTGGTGTGGAGCAGGATGATATCGCAAATGAGGCCGTAAATGAGAGTGGTTCGGGGAAA
ATGCGTCTGGTAGGCAACCTACAGTTGAATTCTATTGACAGAGCCTACGCCTACGAGATCGTCTTCCCGGACCTGTGCGGTAGCTCAAGCGGGAAGGTCT
GGAGATGCGAGCATCCTCTGAGAATTGTCAGCTCTCCGCTGTTACAGCAAGTTTTTAGTGTGCTGGATTGCATTATTCCCCCTGTGGAATTGTGTGCGTA
TAAGGCTCAAGTGGCTTGCTCAGCGCAGCAAAAAGTTCAAAACTCGGCAGAAAACGATTTTTTCGCGGATGGTGGGCTCGAGTGGCAGTCTTTGTCTGAA
TGCATCATGGGTCTGCTGCCCAAGCAAACTGAAAGTATAGATGGAATTGTGCCATCCGCAGCTAACAGCGATGAGGGGATGGCTGTTGCTCCTTCAAGCT
CTTCGTTTGATGCGCTTTGCCAGAGCGAATTTCACGACATGTACCAGTACGAGCATGCAATGCTTTTCGCCACGATGGAGCTACCTGAAACAGAATCCTT
GATGTTCAAAGCCAGAGGAGATCGATTGAATAATCCTTCTGGGATTCAATCTAACAGCAACCACGGGTATTTAGGTATGGTTGGATACATGGAGACCATT
TTTGCTGGACTTCATTTACTCTGCGAAGAATTGAAGCTGTCAATCACGCTCTTTCAGCAGCGATTACATTTAGCGAAGTTGCTGTTCGATACGGCATTGC
GACTGGGCTTGGATCATTTTGTCGCTTATTACAAGGAGGATAACTGCATCCTGATCCGCCAAGGGTTGTTGACAGAGGAAAGTTCCGGAGCGGGGTTCCA
CTCGAAGACCGAAGGGGGGGGATTGCTTCGTTTTACTACGTATGGATGTGTGCCAGACTTGATAATGTGGCTTCAAGACAAGATGACAGCAAAATCACAC
ACATCAGTGGACTTTCCGACGCTTTTCGACAATCCAGAACAACAACAGCTTTCGTCGGATGGCTTGTTTCAGCATCCTGAGAATCCGCTTCGACGAACAA
GAGCCCTTTGTCGCGTGTACGAGCTGATATTTCCAAGATCAGAAGACAGCGCTTCTCAGTTGCCAACCGCGCAGTCAAATGCATTCAAGTTGATCGTCTA
CCTCACCCAAGATCCTATCGGCAGCGCGCTATCATTGGAGGATCTTCCTGTTGGTCTAAGCATCCCTATCGTCCAAACGATTTGCCAAGTGAAACACCAC
CCGCCTCCTTTCATTACCGAAGACATTTGTGCGTTCGTGGGACGAGAAGATCTCAGTATTGCAAGCGCAGAAAATCTGGCCGACCATTTTGACTATTCTG
AAAGTCAACAACAGTATGATCCTGCAACCAAAACAAGAGATTCAAGCAACCAAACTGAGGATGACAGCCGCGATGACTGTGACGGTCTAGAGGACATTAT
AAGTCGGAGTCAACCACTCTTCCCCGCCGACCAGAGAATGAAGGAGGTTGCACGACTGCTACGCTCTAGTCGCCCTCTTTGCCTGAAGTTAGAGAAGACC
CCAGATTTGTCAGACCTTGACTAcgcacagcaacagcaagctcGTTTGTTGCTTCTTTGCAAGCGGTCTATGGCGCTGTCTGTGGCTCGTGGCATGGCGA
CGCTTGGTAGCTTTGATGTTTCTACAGCACAAATGCAAATTTGGCGCCTTCATATACCTGCACTCCCTCTTCAAGGGCGTAAGCCTCCAACAAACGCGAT
TGTGGAGCTTGATCTCTCGGGCTATGCCAAAGAGTTGACTTATTGGCCTCAATTTCATAATGGATGCGCTACAGGACTacggcttccagcgcatgATCTC
TCGGGTGTCATTAACCGCCATTGGATTAAGTATCATCGACCGTCAGTAAATGATATTCCAGTGGGAACTACAGGAGGGCggcaggcagcagcgacccAAT
CAGCTGATACTGCCGGTCGGAATCTAGAAGAGGCGTATGCAGCTCACGCGGGATTATTACTGGGAATAGGCCTACGCGGCCATCTCAAGTGCTTGTCCAT
GGCAGATGTATACAACTACCTCTCTCTATCGAATGAGTTCGTGACGGTTGCCATCATGCTCGGCATGGCTAGCACTGCTGCTCACTGCCGAAGCAAGCGA
AagcaacaagcagcagcaacaaaacCTCATATCAGGAAAGATGAAAGCCACTCCCCGACATCAGGAAACGAAGACTCTGATATGGCACCACTTGAGGCAG
ATCATTTCTTCTCCGGTATTCCTGAGCTTTCGTCGTCGGATAAAAACCCTCTAGTTGGAACGGGTTTGGAGTTAGCATTGGAGCGGTCGGTATCCAAGAT
GCTGTGTCTTCATGTTCCATCCTTGCTTCCTCCGCCATTCGGAGGGTTTTCTGTACCTGCCTCTACTCAGACAGCAGCACTTCTGGGACTTGGCATTTTA
TACCAAGGTTCAGGTTATCGTTTGATGACAGAACTACTGCTCACCGAGATAGCGCGATCTCCGTCGAGCCCCCAATTTGTAGGAAGCAACAGTAATGCGG
GATTGTCGACGGCTTCGTTTGATCAGCTGGAGGGTTACGCTCTAGCGGCAGGAATGGCACTTGGCCTTGTCGTACTTGGACGCGGTCAGACTACAACAGG
AGACCCTGGATTGGCTGAcctcaagctggaggagaagcttcACAAGTATATTGTGGGCGGTGCACAGCAGTACCGGGATGCAAATGCGGCGGGGAGCTGT
CTCTATCGTGGTCGTCGTTGGCAAGCTTTTGGTAGTGGGGGTAATGATTTTAACTCCGCTGTTAATGGTAGTGCCGCAGGTAATGTTACGCCCAATAGCA
ACACCGGGGGATctcctggtgctggccgcgacACAAAACATTCAAATGATCGTAGCGGGGCTCGTAGTGGTGGTGAGCACGTAAACACAGGGGTGACTGC
CTGCGCAAGTGCTCTGGCATTAGCCTTCATGTACATGCAGACCGACAATAGGGCTGTGTCGGCACAATTGGCGGTTCCTGATACACTTATCCTTCTGGAC
TATGTTCGCCCGGATATCCTATTGGCGCGTACACTTGCGAAGAACCTAGTGATGTGGAGCGAAATATCACCGGCAATGGAGTGGATCGATCGTCATGAAG
TCCCTGCGCAACTGCTTCAAGCGTATAAATCTATCCAGTCGCATGGCAGCGATGCAAGAGGAGATGCGAATCGAGTGGAATTTCCAAGTGGCTCGCCATC
ACATTCTGACCTTCACTCAATTTGCGAGGCCTATGCGAATATTGTAGCAGGTGCGTGCTTGAGCATTGGGCTGCGGTTTGCTGGAACAGGCAACACGTCA
GCTCGAGGCACACTCCGCAAGTACGTTTTACACTTTCGTGAACTAAGAACGAAGGCTTCCTCGTCATCAATTATGCGTGGAAGTAGCaacgttgttgctg
ctgcgacggaGCGCGTGACCGTCGAGCGGTGCTTAGCTGTGTGCGCACAGGCACTGGCTTTGGTTGACGCTGGAACGGGTCATGTGAAAACACTGGCACT
GTTGCGCTCGATAACATTGCGGCAGCGGGTGGACGCAGCAATGAGCTACGGCAACCACATGGCTCTGAGTATGGCGATCGGGTTGCTTTTCCTGGGTGGT
GGACGCGCCACAGTTGCACGATCTAAAGAGGCTATTGCTGCACTTGTGATCTCATTATACCCGATGCCTCCCATGAATACGGCTGACAACAAGTATCATC
TGCAGGCTTTCCGTCACCTATACGTACTGGCAGTTGATACCTCTCGATTGGTGGAGACCGTGGATGTGAATACTAAAGTGACCTGTGCTGTTCAAGTTCG
AGTCGACCTTCATCCTGGTGAAAACGGTTCTGTAGATGAGACCGAGCCTTCGTATCGAATGCTTCGAAGTCCATGCCTTCTTCCAGATATCACAACGATC
AAATGCCTCGTCATCTCTGATCCTGAATTCTATCCGATTGAGATTCTgacgtcttcatcgtccgaCGAACGAACATCTTCGGAGACTGGCAAAGTGAGAA
CAGCCAATTCACTGCGGTTAGAACTCTTGCGAAACAAAAACGTGGTTTTCCTGAAGCGTCGACAGAGGAAAAACTTCGGGGGCTTTGCGGACTTtacgga
ggagctggagcagctacACGATGGGCAGGTGGGGCATCACCTTGGTGGTAATAACCACGATGATCGACTGCGGAGACTTTTTCGCTTGTACTTCACGACG
GGTGTGAgcggtggcgatgacgactGTGAAGATGGAGAGGATGAGGTAGATCAACTTGATGTGGCAGATTGGGGCAGCAGTTGGTGGGCATCTCAGTTGA
GTCCACGGGCGCTAGAACACGTCAAAGAGGAGGCGCAGTTGCTAATGCCACCATATCTTAATGCTTTGTACGCTCTCTttcggctgcagcaagtgccgcA
GTTGGCAAGTGCCACAGAGATCGTGGACTTAAACCTGTTCAGTAAATACTGCCGTCTGCAAGTGCCTCTCCTGGAGAACTCGTCCGACTCGAGAAGTGAT
GAAGTGCATTCGGGAATTGAGAGCAGGCCAGGAATTACGGAGAAGATCCCATCATTATCCGAGTTTGGCGTGTGGCTATCAAACCAGACGGAGGAAGCTC
TTGGTGCCCTCTGGCATCGAACCTCGTTAGATATTACTTCGCTGGCTTCAGCGCGAGTTCAACTGCTGGTGGGAGCTACACCGTCAGCATCGCCAACGAA
GCGAGCCCAGTCTGTGGTGGATGCGTTCTTCGTGAGTGTGCTGGTGCGGTACTTCGCTGGCCCTTCGGTATCTTCGTTACCGAGTGTAGGCCAGCCTATA
CCTGCTGACAAACATTGGAAAGCCAAGTTCCAACGAGTGCTGGCCGCATGCTCGCAAGCCCAACTGGGCACAAAATCGCCGGCAAGATTCCAGTTGCCTG
CTTTTCTCGAGCAGGATGAACTCACGGAAGCCGAAAAGACCTTTTGGCTCAAATTGGTGTCGTTCTTCCTCTTTTCAAACTA
	
	
ATGGCGGCGGATGCGGAAGATGCGGCGCCAAGTATCCGCGTGACCTGCGCAGGCGTGCGCGCGAACCCGCGCAGGTCGCAGCCGGCGGACAACGGGTGCG
TGTTCTTCAGCGAGTCGCAGTACGCTTCGTCCCCTTTCCTCGTGCGCGTGACCTTCGACAGCGTCAGCTTCGTCCACCGCGGGACGCACGTCGTGGAGCG
GCGCTTCGTCTTTCCaggccgcgtgctgcacgctgtGCTGGCGGATTTCTCCCAAGAAACGTTAAATAGTACAGCAACGCCCAAAAATGGGTCCGCGGAG
CGCAGACGAGCGCGGAAAGCGGCGCGAAAGCCTCGTCCGCACCCGCATTTGTGCGTCTTGGTGCGCTCCGACTGCCTAAATGTGTACACCGCAACTGGGG
AGGTCTtcgaggtggcgctgccctTCCAGGCTAATAGACTCTTCCCCGTAGAGGGGTGGGGCTTGCTGCTACAGCGCAGtccggcggcggcggtcccgtc
cacggcgtcgaagcgccctcgagacgctgctgcggtggcgctggccaggaAGAATCGACGTGCGAGCACCAGTAACAGAGGAGACGGAGATAGATACAAG
TACAGTTCAGGGGAGAAGGGGGTGCCGGCGAGACCGAGGTACTTTACGCTCAGGCACCCGCTGGATGAGGTCAAGCCGGTGGCGTTGAGAGCGGTAGGAG
GCGTGACGGGGAAAAGGGAGGAGAAGTTTCTGTCGGActcggcgctggaagctgtggacgtgctggaggaagcaGTGTCCCCCGTTCTGGTGGCATTTCA
TCGATGGGAGCAGAGGTTTTATGTTTTTCGGATGAATGTGGTGGAGAAATTGAAGAGTTGTGTGATGCCGGAGGTGAGAGTGGTGGATGGaccgacgtgg
acgagataCCGTGCTAGAAGCGACTTGGAGGAATTGCGCGTGCGGATTGAGCCGGATTGGATGGCAACGATGCTGTGGAAATCGCCACGTGTTGGGCCAG
CGACTTCGAAGCCGATGTTTCTGTCCCCGATCGTCTCGCCTTCTGTCTTGACTGCTTCACCTGTTCCACCATCGCCGATAACGACCAATACGTCGTCGAC
CTCGTCTGGGAACGTTACCAAGGTGGCATTTATCGTGTCAGGTGTCGATGGTCTTCCATTGTTGTGCATAATGGACAAGGATGCTGGAACTCTGCTTCTG
AAACCCATTTCACAGCAAGAGCCCACTACAGCAATGCTCGACGAAGGAGGCAATGAAATCGGTGGCATTCGTCTCTTGCACTGTCGTGACGCGGTTCCGA
TCAGGCAGCAAGATTACGCAGGATCGCGTGAAGGTGGCAAAGGCCGAGGCTTCGAGGGTTCCACCGATATTGTGGTGCTCGAAAAGGATGGCACGCTCAT
GCTGTATAGAGCGCATCATCCAATTTGCCGCCTGGTTCTTCCTGGTGTGGAGCAGGATGATATCGCAAATGAGGCCGTAAATGAGAGTGGTTCGGGGAAA
ATGCGTCTGGTAGGCAACCTACAGTTGAATTCTATTGACAGAGCCTACGCCTACGAGATCGTCTTCCCGGACCTGTGCGGTAGCTCAAGCGGGAAGCGGG
TGGACGCAGCAATGAGCTACGGCAACCACATGGCTCTGAGTATGGCGATCGGGTTGCTTTTCCTGGGTGGTGGACGCGCCACAGTTGCACGATCTAAAGA
GGCTATTGCTGCACTTGTGATCTCATTATACCCGATGCCTCCCATGAATACGGCTGACAACAAGTATCATCTGCAGGCTTTCCGTCACCTATACGTACTG
GCAGTTGATACCTCTCGATTGGTGGAGACCGTGGATGTGAATACTAAAGTGACCTGTGCTGTTCAAGTTCGAGTCGACCTTCATCCTGGTGAAAACGGTT
CTGTAGATGAGACCGAGCCTTCGTATCGAATGCTTCGAAGTCCATGCCTTCTTCCAGATATCACAACGATCAAATGCCTCGTCATCTCTGATCCTGAATT
CTATCCGATTGAGATTCTgacgtcttcatcgtccgaCGAACGAACATCTTCGGAGACTGGCAAAGTGAGAACAGCCAATTCACTGCGGTTAGAACTCTTG
CGAAACAAAAACGTGGTTTTCCTGAAGCGTCGACAGAGGAAAAACTTCGGGGGCTTTGCGGACTTtacggaggagctggagcagctacACGATGGGCAGG
TGGGGCATCACCTTGGTGGTAATAACCACGATGATCGACTGCGGAGACTTTTTCGCTTGTACTTCACGACGGGTGTGAgcggtggcgatgacgactGTGA
AGATGGAGAGGATGAGGTAGATCAACTTGATGTGGCAGATTGGGGCAGCAGTTGGTGGGCATCTCAGTTGAGTCCACGGGCGCTAGAACACGTCAAAGAG
GAGGCGCAGTTGCTAATGCCACCATATCTTAATGCTTTGTACGCTCTCTttcggctgcagcaagtgccgcAGTTGGCAAGTGCCACAGAGATCGTGGACT
TAAACCTGTTCAGTAAATACTGCCGTCTGCAAGTGCCTCTCCTGGAGAACTCGTCCGACTCGAGAAGTGATGAAGTGCATTCGGGAATTGAGAGCAGGCC
AGGAATTACGGAGAAGATCCCATCATTATCCGAGTTTGGCGTGTGGCTATCAAACCAGACGGAGGAAGCTCTTGGTGCCCTCTGGCATCGAACCTCGTTA
GATATTACTTCGCTGGCTTCAGCGCGAGTTCAACTGCTGGTGGGAGCTACACCGTCAGCATCGCCAACGAAGCGAGCCCAGTCTGTGGTGGATGCGTTCT
TCGTGAGTGTGCTGGTGCGGTACTTCGCTGGCCCTTCGGTATCTTCGTTACCGAGTGTAGGCCAGCCTATACCTGCTGACAAACATTGGAAAGCCAAGTT
CCAACGAGTGCTGGCCGCATGCTCGCAAGCCCAACTGGGCACAAAATCGCCGGCAAGATTCCAGTTGCCTGCTTTTCTCGAGCAGGATGAACTCACGGAA
GCCGAAAAGACCTTTTGGCTCAAATTGGTGTCGTTCTTCCTCTTTTCAAACTAG
	
	
MAADAEDAAPSIRVTCAGVRANPRRSQPADNGCVFFSESQYASSPFLVRVTFDSVSFVHRGTHVVERRFVFPGRVLHAVLADFSQETLNSTATPKNGSAE
RRRARKAARKPRPHPHLCVLVRSDCLNVYTATGEVFEVALPFQANRLFPVEGWGLLLQRSPAAAVPSTASKRPRDAAAVALARKNRRASTSNRGDGDRYK
YSSGEKGVPARPRYFTLRHPLDEVKPVALRAVGGVTGKREEKFLSDSALEAVDVLEEAVSPVLVAFHRWEQRFYVFRMNVVEKLKSCVMPEVRVVDGPTW
TRYRARSDLEELRVRIEPDWMATMLWKSPRVGPATSKPMFLSPIVSPSVLTASPVPPSPITTNTSSTSSGNVTKVAFIVSGVDGLPLLCIMDKDAGTLLL
KPISQQEPTTAMLDEGGNEIGGIRLLHCRDAVPIRQQDYAGSREGGKGRGFEGSTDIVVLEKDGTLMLYRAHHPICRLVLPGVEQDDIANEAVNESGSGK
MRLVGNLQLNSIDRAYAYEIVFPDLCGSSSGKRVDAAMSYGNHMALSMAIGLLFLGGGRATVARSKEAIAALVISLYPMPPMNTADNKYHLQAFRHLYVL
AVDTSRLVETVDVNTKVTCAVQVRVDLHPGENGSVDETEPSYRMLRSPCLLPDITTIKCLVISDPEFYPIEILTSSSSDERTSSETGKVRTANSLRLELL
RNKNVVFLKRRQRKNFGGFADFTEELEQLHDGQVGHHLGGNNHDDRLRRLFRLYFTTGVSGGDDDCEDGEDEVDQLDVADWGSSWWASQLSPRALEHVKE
EAQLLMPPYLNALYALFRLQQVPQLASATEIVDLNLFSKYCRLQVPLLENSSDSRSDEVHSGIESRPGITEKIPSLSEFGVWLSNQTEEALGALWHRTSL
DITSLASARVQLLVGATPSASPTKRAQSVVDAFFVSVLVRYFAGPSVSSLPSVGQPIPADKHWKAKFQRVLAACSQAQLGTKSPARFQLPAFLEQDELTE
AEKTFWLKLVSFFLFSN_