Scaffold : Scaffold_1
Gene_id : Phypl_g18
Description : hypothetical protein PHYSODRAFT_552363
ATGGCGTCGCAACGGAGAGGCTCCGCTCCGCGCGGGgacggcagcttggccgccatCTGCATGCTCATCGAGCGCAGCACTCTGGACCGCAAGTCCAAGC
TCGACAGCACGGGCCGCGTGTGCTACGTACGTCCTtaagcccccccccccattcATGCATACAATACCCTGATACAACGAACGTATCACCCACCgtgagc
aggagctgaagaacgacccgctgctgctcgacagcttcCCCATGGAGCGGCTCATGAAGGCCATGCGCCGACTGGTGTGCGACTCGgacacgtccacgcg
cgCGGGGGCGCTCCGGGCGCTGCGCTACGCcatcagcagcggcggcagcgtcaaGCACTTCGCAGACCTCAACCTGCCCGTGTTCGtggtgcgctcgctg
gagcgcgagcagaaGCACTTGGCGGAGCGCGTCCAAGCTCTCAAGGTCGTGCGGAGGAtcatggagatcgacgcggCGCAGATGCCCACGGGGCTCGTGT
GCTCGCTGTCGGCCATTGCAGGCCACAAGGACGACAACATGCGCCGGGTGTGtctggagacgctgcgagagctggcgctgctgaacgtgGAGGTCGTGGC
GGAGGCGAACGGCACCAAGACCCTCGTGGATGCGATCCTGGAGCCGTCGTTCCAGGACCTGGCCGACTCGCTGctcatgacgctgctgcttaTTCTGAAC
GAACCGTCGACCCGCAAGTTTATTGAGCCTTTTGTGGACTCacaggtgctgctggctccGTTTACAGACACCGACTTGCCAGCGGGAAACGAGCGGAGGC
AGCGATGGATGGCGAGTCGGAACGCTATCGTGACGATGATGCGATCGTGGACAGggatggtggtgctgacgagCAACCCGCAGGGCCTGCAGTCGCTGAt
tcagctgctcgtgcggcCGGTTGGAGAGGACGTACAGAAAGCGGTGCTCTCTACTATTTGTGAAATCTTTTACAAGAAGACGAGCTTCGACAAGTCAGCA
GCTGATGCAGGAGCGGACACCCCTGCTCTCCCTGTGACCCTGTCGAGTGCAGAGCAGTTGCCACTTGCAGTGAACCACAATCTTCTGGACAATTACACGG
TGATTATCCTTCTGGCCATGGTCCACTGTGGCATCCTAGAGGCGCTGGTGACTCTAGGCACGGGACCATCTCGAGCATTAGCGGAGCCGGCAATTGACCT
GCTGGCTGATATTCTGCGTATGGCCTCCCGTCTGCTGCCGGACCAGCACTGTGCTTCATTGCTTGCGCTTCCGCGGCTCGTATCGTCGACCTcgctcacg
acgacgaccacaATGTCTCTCGGAGATCATGCTAAGAGTCTGTTGGAGCGGCTACAACGCGAAAAGTCGATTCGAGCTAGTGAAATGTTGGGTGAGCTGG
CGAATGCTGTCGGCGCCAATTCAGGTAGCATTGCCACGCGTGGGGTGTCGCTAGTCTCGTACGGCGGTAGCGGTGTTAATGGTGTGCAACTGGCGTCCGA
GCTCCTACGCGACACAAATCGGCCGTCAAATCTCCTGGCCCTGCAGCAGATTGCAGGGGTGGTGCGTCTTCCGTCCTCtagtggcggcggtggtATCGGC
GGTACTGGCAGTGGTTCTGCTAACTACGCTGTAGCAGCTCCTTCAACACAGCGTGGCACGAAGAGTGCGACGGCGCAACTTAAGGACAGTCTAACGTCGC
GAGAGCTTATGGTTctcgagctgaagcagtcgctggacgcACAGATGGACGACAGCACTTTTAAGGACATGCTTCACAACCGCTCGCGCGTGCTAACGGA
CAAGAACTACAAAAACTGGAACTGGGATATCATTTCCGAAATGCTCGAGGGCCCACTGACGAACCCGCAACGGCTCTCGGAGGCAATGAAAaccaagttc
ttcaagcGTCTTTCAGGTTTCTTCCGTTGCGACCAGGGCAACAAGGGGTATTTCTCGAATCTGTACTGGATTCCGGATCACGTGCCCTACTTGCGTCCGG
CCTGTCAGATGTATACGCTGCTGTTGAATCACCCCGAAGGTctgctcttcttgaagaCCGACCGCCGCGGTCAACTACTAACAGAAATTTCATCAGCACT
AGAGCTGGAGGCTCGCCCCGAAGCTGCTATCGTGGAGTCGCATATCGGTGTGCTTAAGGCGCGCATGTTTTCACCTGACTACGTCTCGCGGCGTATGTTG
CGCGAGTACTTTACGCTTCTGGGACTGATGAGCTCGAGCAAAGAGGGTCTGAAGATGATGGAACAGTCAAATCTGTTCCAGCGGCTTTACGTCATGGGCA
CAACCAAGGGCCACGATTTCCTGTGCCGCCTAATTCTAGCTAACCTGGACTACTCGGTTGACGGCAGCTCTCGGAAGCTGCTCCAGTCTTGGATGATGGA
GGGTTCTAAGGCACTGCGTTTGTATGCAACCTGCTTACTACGTGCTCTCCTGCGTTCTGAGGTGGCAGATTTCGATAAGTGGGGTATTGACGCGCTGGTG
ACTCAGCTCacgcaggaagaagaggttGCCAAGGCAGCGCTGAGCGTCTTGGAAGAGGCTGCTGAGACGCCCGCCTGCCTTCTGGCTATGATTCTGAAGC
GGCCAATGAAATTAATTCAGCTGAAGGATAAGCGCGCTGAATCCCTGCTTCTCAAGTCGCTCTCGCTAGCTGAGGGACTGAACTTCCTGCGTGACACAGG
CGACTGGATCCCGCGTACCCTTGCTGCCTGGCGTCGTGAAAAACATATTTCGTACGTGCATGCTGTAGAGCACGCGCTTTTCCGTGGCTTGCACCGCGAT
GCTGCCGGGCGTGAACGCGGATCGAACAGTAGCTCAACCAACACACGCCAAATATGCTCTCCCACTCCCATCCCCGTGAATGTGCCCATGAAGCGAGGTG
GTGGTGTCGGGCTCAAACCACCGAGTGGTGGAAGCAGCCAGCGCTCCTTGTGGGGACTGGATTGGCTCTATCGTATGCCATGGAACATGGAGGTAAAGAT
TGTGGGCCCTCCAGGAAGCGGCCCTCCTTCGAACCTCATCTTGGAAACGTACATCGATGGTGCGATGCGCGACGAGCATGAGACTACCGGAATCGACGAT
GAGCTTCGCATGAACTCAATCCGAGTAAAGGGAATTGTTGTGGACGCGCGCAACATGCCGCAGCCTGTGGTTGTGAACTCACAGCAGACACTGCAGGCTT
GCCTCTTCCTGGGCACGCAACCGGTAGACCGGCGCGGGTTTACGAAGCCCCCTCCGCAGAGCAATGGAGGTTTTGTCTCTACAAGCGGATCTGCTAGCGG
TGGTGGAACTGCTCTTTCAAGTGAtgcgcagcagaagatgcTGCGTGCTCGTTCGGCGTCGAATTCGGCAGGAGGAAGTATGGACCGTAGCTCGGAGACT
ACGATGGCTTCGTCGTTGGACTTTGCCGATACTGGATCGTCTTCAGCCGATGCAGCGAAGGAAGAGAACAAGGACTGGAGTTCGTGTCAGCCAGAACAGC
GCTCTCCGCAGTATCTAACAGCACCGGAGTGTTCTCTGTGTGCCCCGGGTGAACGTGCTGTGTGGAACTTCCGTGTGGAAATGGACTCGGCGGCTGGCAC
AAACACTTCAAACGGAAGCGTAAAACGTCTGCTGCTTAAGTCTGTCGAGTTCACGCTACAGTTGCTGCCCCTTCGTCCGCGTACTgtgccgctgccggtg
cACCTGTACGGCGAGCTGGCGAAGACCAGTGCTGGTTGCCAGATCCTGCACGCGTCTGGGCATTTGCCGGAATTCCTGGCCTGCCTTCGCGATGCCGCCA
GCGTCCCGCTTGAGAAGCGTGCTGCACTGTGGGCGCTTGGTCACGTGTCGGCCACACCACGCGGCTACGATCTGCTGAACCACTACGCGCAAGACTTTGT
GGAGATGATTGTGAAACTAGCCACCGATTCCCCGCTCGTATCCATTCGCGGAACttgcttcttcgtgctgggTTTGCTCGCACGGTCGCCTGTAGGACGA
CGACACTTGGCACGTCTTGGGTGGGATGCCCCGCGTGGTGCATCTCGTACTTCCATCGCCGTCCCGCAGAATTGCACGTCTCTCTTTATGTGGCCACCGT
CTGGATCCTCAACGCCTAGCCCATTGACACAGACGCCTCGTGCTTCGCCGCTACAGCGACTGCTAATCCGCAGGCGTGACAAGATGCCCAATGAGTGGCG
GGAAGTCCTGCGCTTTGTTGCAGACCTGAGCAACCACATCACCCAGAAGGAGGCTCATGCTTcgctcaacaagctgcgTTCATCCAAGTCGGAGCTATTC
GAAGAGCCAGTGCTTCTGATGTATGTGCACGCTCTACTGGAGAAGTACAGCTACCGTTTGGCGCTACGCCAGTTCGTGCTCAACGCGTTCGACCGAGCAA
CATTGACTGATGAAGTGCTGGATACGCTTCGGAttgaggacgaagaggagcaCGGCAACCAAACGCGTCAACGCGTGCCAACGGGGcgggagctgcggcg
gcgtcgctcgtCGCCTTCAATCCCGTCATTTACGGCCTCGGTCCAGTCGCTGAACGCTGCCATGCAGGCCACCTCTGGTGTCTCGCGCATGTCGTCCATG
CAGAACGTGCTGAGCACTGGCGGCAACATGGGCGACCACCGTTCCACCATGCGGCTGAACGCGCACAACGACCTCATCGATCGCACGGTACTGCTCAAGC
GCAATCGCAAGCGCTCTGCTTTCTCCGAGAAAACCATCGTTGTCGGTgcacctgaagctgctgtgtA
	
	
ATGGCGTCGCAACGGAGAGGCTCCGCTCCGCGCGGGgacggcagcttggccgccatCTGCATGCTCATCGAGCGCAGCACTCTGGACCGCAAGTCCAAGC
TCGACAGCACGGGCCGCGTGTGCTACgagctgaagaacgacccgctgctgctcgacagcttcCCCATGGAGCGGCTCATGAAGGCCATGCGCCGACTGGT
GTGCGACTCGgacacgtccacgcgcgCGGGGGCGCTCCGGGCGCTGCGCTACGCcatcagcagcggcggcagcgtcaaGCACTTCGCAGACCTCAACCTG
CCCGTGTTCGtggtgcgctcgctggagcgcgagcagaaGCACTTGGCGGAGCGCGTCCAAGCTCTCAAGGTCGTGCGGAGGAtcatggagatcgacgcgg
CGCAGATGCCCACGGGGCTCGTGTGCTCGCTGTCGGCCATTGCAGGCCACAAGGACGACAACATGCGCCGGGTGTGtctggagacgctgcgagagctggc
gctgctgaacgtgGAGGTCGTGGCGGAGGCGAACGGCACCAAGACCCTCGTGGATGCGATCCTGGAGCCGTCGTTCCAGGACCTGGCCGACTCGCTGctc
atgacgctgctgcttaTTCTGAACGAACCGTCGACCCGCAAGTTTATTGAGCCTTTTGTGGACTCacaggtgctgctggctccGTTTACAGACACCGACT
TGCCAGCGGGAAACGAGCGGAGGCAGCGATGGATGGCGAGTCGGAACGCTATCGTGACGATGATGCGATCGTGGACAGggatggtggtgctgacgagCAA
CCCGCAGGGCCTGCAGTCGCTGAttcagctgctcgtgcggcCGGTTGGAGAGGACGTACAGAAAGCGGTGCTCTCTACTATTTGTGAAATCTTTTACAAG
AAGACGAGCTTCGACAAGTCAGCAGCTGATGCAGGAGCGGACACCCCTGCTCTCCCTGTGACCCTGTCGAGTGCAGAGCAGTTGCCACTTGCAGTGAACC
ACAATCTTCTGGACAATTACACGGTGATTATCCTTCTGGCCATGGTCCACTGTGGCATCCTAGAGGCGCTGGTGACTCTAGGCACGGGACCATCTCGAGC
ATTAGCGGAGCCGGCAATTGACCTGCTGGCTGATATTCTGCGTATGGCCTCCCGTCTGCTGCCGGACCAGCACTGTGCTTCATTGCTTGCGCTTCCGCGG
CTCGTATCGTCGACCTcgctcacgacgacgaccacaATGTCTCTCGGAGATCATGCTAAGAGTCTGTTGGAGCGGCTACAACGCGAAAAGTCGATTCGAG
CTAGTGAAATGTTGGGTGAGCTGGCGAATGCTGTCGGCGCCAATTCAGGTAGCATTGCCACGCGTGGGGTGTCGCTAGTCTCGTACGGCGGTAGCGGTGT
TAATGGTGTGCAACTGGCGTCCGAGCTCCTACGCGACACAAATCGGCCGTCAAATCTCCTGGCCCTGCAGCAGATTGCAGGGGTGGTGCGTCTTCCGTCC
TCtagtggcggcggtggtATCGGCGGTACTGGCAGTGGTTCTGCTAACTACGCTGTAGCAGCTCCTTCAACACAGCGTGGCACGAAGAGTGCGACGGCGC
AACTTAAGGACAGTCTAACGTCGCGAGAGCTTATGGTTctcgagctgaagcagtcgctggacgcACAGATGGACGACAGCACTTTTAAGGACATGCTTCA
CAACCGCTCGCGCGTGCTAACGGACAAGAACTACAAAAACTGGAACTGGGATATCATTTCCGAAATGCTCGAGGGCCCACTGACGAACCCGCAACGGCTC
TCGGAGGCAATGAAAaccaagttcttcaagcGTCTTTCAGGTTTCTTCCGTTGCGACCAGGGCAACAAGGGGTATTTCTCGAATCTGTACTGGATTCCGG
ATCACGTGCCCTACTTGCGTCCGGCCTGTCAGATGTATACGCTGCTGTTGAATCACCCCGAAGGTctgctcttcttgaagaCCGACCGCCGCGGTCAACT
ACTAACAGAAATTTCATCAGCACTAGAGCTGGAGGCTCGCCCCGAAGCTGCTATCGTGGAGTCGCATATCGGTGTGCTTAAGGCGCGCATGTTTTCACCT
GACTACGTCTCGCGGCGTATGTTGCGCGAGTACTTTACGCTTCTGGGACTGATGAGCTCGAGCAAAGAGGGTCTGAAGATGATGGAACAGTCAAATCTGT
TCCAGCGGCTTTACGTCATGGGCACAACCAAGGGCCACGATTTCCTGTGCCGCCTAATTCTAGCTAACCTGGACTACTCGGTTGACGGCAGCTCTCGGAA
GCTGCTCCAGTCTTGGATGATGGAGGGTTCTAAGGCACTGCGTTTGTATGCAACCTGCTTACTACGTGCTCTCCTGCGTTCTGAGGTGGCAGATTTCGAT
AAGTGGGGTATTGACGCGCTGGTGACTCAGCTCacgcaggaagaagaggttGCCAAGGCAGCGCTGAGCGTCTTGGAAGAGGCTGCTGAGACGCCCGCCT
GCCTTCTGGCTATGATTCTGAAGCGGCCAATGAAATTAATTCAGCTGAAGGATAAGCGCGCTGAATCCCTGCTTCTCAAGTCGCTCTCGCTAGCTGAGGG
ACTGAACTTCCTGCGTGACACAGGCGACTGGATCCCGCGTACCCTTGCTGCCTGGCGTCGTGAAAAACATATTTCGTACGTGCATGCTGTAGAGCACGCG
CTTTTCCGTGGCTTGCACCGCGATGCTGCCGGGCGTGAACGCGGATCGAACAGTAGCTCAACCAACACACGCCAAATATGCTCTCCCACTCCCATCCCCG
TGAATGTGCCCATGAAGCGAGGTGGTGGTGTCGGGCTCAAACCACCGAGTGGTGGAAGCAGCCAGCGCTCCTTGTGGGGACTGGATTGGCTCTATCGTAT
GCCATGGAACATGGAGGTAAAGATTGTGGGCCCTCCAGGAAGCGGCCCTCCTTCGAACCTCATCTTGGAAACGTACATCGATGGTGCGATGCGCGACGAG
CATGAGACTACCGGAATCGACGATGAGCTTCGCATGAACTCAATCCGAGTAAAGGGAATTGTTGTGGACGCGCGCAACATGCCGCAGCCTGTGGTTGTGA
ACTCACAGCAGACACTGCAGGCTTGCCTCTTCCTGGGCACGCAACCGGTAGACCGGCGCGGGTTTACGAAGCCCCCTCCGCAGAGCAATGGAGGTTTTGT
CTCTACAAGCGGATCTGCTAGCGGTGGTGGAACTGCTCTTTCAAGTGAtgcgcagcagaagatgcTGCGTGCTCGTTCGGCGTCGAATTCGGCAGGAGGA
AGTATGGACCGTAGCTCGGAGACTACGATGGCTTCGTCGTTGGACTTTGCCGATACTGGATCGTCTTCAGCCGATGCAGCGAAGGAAGAGAACAAGGACT
GGAGTTCGTGTCAGCCAGAACAGCGCTCTCCGCAGTATCTAACAGCACCGGAGTGTTCTCTGTGTGCCCCGGGTGAACGTGCTGTGTGGAACTTCCGTGT
GGAAATGGACTCGGCGGCTGGCACAAACACTTCAAACGGAAGCGTAAAACGTCTGCTGCTTAAGTCTGTCGAGTTCACGCTACAGTTGCTGCCCCTTCGT
CCGCGTACTgtgccgctgccggtgcACCTGTACGGCGAGCTGGCGAAGACCAGTGCTGGTTGCCAGATCCTGCACGCGTCTGGGCATTTGCCGGAATTCC
TGGCCTGCCTTCGCGATGCCGCCAGCGTCCCGCTTGAGAAGCGTGCTGCACTGTGGGCGCTTGGTCACGTGTCGGCCACACCACGCGGCTACGATCTGCT
GAACCACTACGCGCAAGACTTTGTGGAGATGATTGTGAAACTAGCCACCGATTCCCCGCTCGTATCCATTCGCGGAACttgcttcttcgtgctgggTTTG
CTCGCACGGTCGCCTGTAGGACGACGACACTTGGCACGTCTTGGGTGGGATGCCCCGCGTGGTGCATCTCGTACTTCCATCGCCGTCCCGCAGAATTGCA
CGTCTCTCTTTATGTGGCCACCGTCTGGATCCTCAACGCCTAGCCCATTGACACAGACGCCTCGTGCTTCGCCGCTACAGCGACTGCTAATCCGCAGGCG
TGACAAGATGCCCAATGAGTGGCGGGAAGTCCTGCGCTTTGTTGCAGACCTGAGCAACCACATCACCCAGAAGGAGGCTCATGCTTcgctcaacaagctg
cgTTCATCCAAGTCGGAGCTATTCGAAGAGCCAGTGCTTCTGATGTATGTGCACGCTCTACTGGAGAAGTACAGCTACCGTTTGGCGCTACGCCAGTTCG
TGCTCAACGCGTTCGACCGAGCAACATTGACTGATGAAGTGCTGGATACGCTTCGGAttgaggacgaagaggagcaCGGCAACCAAACGCGTCAACGCGT
GCCAACGGGGcgggagctgcggcggcgtcgctcgtCGCCTTCAATCCCGTCATTTACGGCCTCGGTCCAGTCGCTGAACGCTGCCATGCAGGCCACCTCT
GGTGTCTCGCGCATGTCGTCCATGCAGAACGTGCTGAGCACTGGCGGCAACATGGGCGACCACCGTTCCACCATGCGGCTGAACGCGCACAACGACCTCA
TCGATCGCACGGTACTGCTCAAGCGCAATCGCAAGCGCTCTGCTTTCTCCGAGAAAACCATCGTTGTCGGTgcacctgaagctgctgtgtAG
	
	
MASQRRGSAPRGDGSLAAICMLIERSTLDRKSKLDSTGRVCYELKNDPLLLDSFPMERLMKAMRRLVCDSDTSTRAGALRALRYAISSGGSVKHFADLNL
PVFVVRSLEREQKHLAERVQALKVVRRIMEIDAAQMPTGLVCSLSAIAGHKDDNMRRVCLETLRELALLNVEVVAEANGTKTLVDAILEPSFQDLADSLL
MTLLLILNEPSTRKFIEPFVDSQVLLAPFTDTDLPAGNERRQRWMASRNAIVTMMRSWTGMVVLTSNPQGLQSLIQLLVRPVGEDVQKAVLSTICEIFYK
KTSFDKSAADAGADTPALPVTLSSAEQLPLAVNHNLLDNYTVIILLAMVHCGILEALVTLGTGPSRALAEPAIDLLADILRMASRLLPDQHCASLLALPR
LVSSTSLTTTTTMSLGDHAKSLLERLQREKSIRASEMLGELANAVGANSGSIATRGVSLVSYGGSGVNGVQLASELLRDTNRPSNLLALQQIAGVVRLPS
SSGGGGIGGTGSGSANYAVAAPSTQRGTKSATAQLKDSLTSRELMVLELKQSLDAQMDDSTFKDMLHNRSRVLTDKNYKNWNWDIISEMLEGPLTNPQRL
SEAMKTKFFKRLSGFFRCDQGNKGYFSNLYWIPDHVPYLRPACQMYTLLLNHPEGLLFLKTDRRGQLLTEISSALELEARPEAAIVESHIGVLKARMFSP
DYVSRRMLREYFTLLGLMSSSKEGLKMMEQSNLFQRLYVMGTTKGHDFLCRLILANLDYSVDGSSRKLLQSWMMEGSKALRLYATCLLRALLRSEVADFD
KWGIDALVTQLTQEEEVAKAALSVLEEAAETPACLLAMILKRPMKLIQLKDKRAESLLLKSLSLAEGLNFLRDTGDWIPRTLAAWRREKHISYVHAVEHA
LFRGLHRDAAGRERGSNSSSTNTRQICSPTPIPVNVPMKRGGGVGLKPPSGGSSQRSLWGLDWLYRMPWNMEVKIVGPPGSGPPSNLILETYIDGAMRDE
HETTGIDDELRMNSIRVKGIVVDARNMPQPVVVNSQQTLQACLFLGTQPVDRRGFTKPPPQSNGGFVSTSGSASGGGTALSSDAQQKMLRARSASNSAGG
SMDRSSETTMASSLDFADTGSSSADAAKEENKDWSSCQPEQRSPQYLTAPECSLCAPGERAVWNFRVEMDSAAGTNTSNGSVKRLLLKSVEFTLQLLPLR
PRTVPLPVHLYGELAKTSAGCQILHASGHLPEFLACLRDAASVPLEKRAALWALGHVSATPRGYDLLNHYAQDFVEMIVKLATDSPLVSIRGTCFFVLGL
LARSPVGRRHLARLGWDAPRGASRTSIAVPQNCTSLFMWPPSGSSTPSPLTQTPRASPLQRLLIRRRDKMPNEWREVLRFVADLSNHITQKEAHASLNKL
RSSKSELFEEPVLLMYVHALLEKYSYRLALRQFVLNAFDRATLTDEVLDTLRIEDEEEHGNQTRQRVPTGRELRRRRSSPSIPSFTASVQSLNAAMQATS
GVSRMSSMQNVLSTGGNMGDHRSTMRLNAHNDLIDRTVLLKRNRKRSAFSEKTIVVGAPEAAV_