Scaffold : contig_69
Gene_id : Phyra_g9866
Description : hypothetical protein
TGTCGCTCCCAGTCACAAGCTGGAAGCGTTTCGCTCGCGAACTGCACGATGGACGCATCGAGCAGATCTGCATCCTCTCGGACGTCGAGAGGATGACGTG
TGAAGCAGAAGAGCTGAATCAGCTCATCTCTGAGGGCGCGGACGCCCTCAGCGCGAAGTCGAAGAAGGAACGCTTCGACGAGCAAGGCTGGGACTCGCTC
AAGGCGAGCCCCTTTTACAAGGTCTTGCGTGAGTACAAGGATGTACTCCCGGACGACATTCCTGCGGAGTTACCGCAGGACAAGGGTGTTCAGCACGAGA
TTGATCTCGTGCCGGGAACGAAGTACTGCGTCACGCGACAGTGGCCACTGCCGCGTGAGCAAGTCAAGGCAATCGACGACTTCTTTGAAAGTCGTCGCAA
TGCAGGACAAGTGCGGGAATCGAAGTCCCCGCACAGCGCGCCTACGTTCTGTGTGAAGAAACCACAGGGCGGGTGGCGCATCGTTCATGCGTACAACAAG
CTGAACGATGCGACGGTACCGGCACAGACGCCGATACCTCGAAAAGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGTACTCTGGATCTGA
GAGACGGGTTCTATCAGATCCTCATGCGTGAGAGTGATATCCCTCTCACGGCGGTAAGCACTCCGAGCGGCATGCTCTGGGAGTGGCTCGTGATGCCGCA
GGGGCTGAAGAACGCCCCAGCGACGTTCAACAGGTGCGTCACGCACTTGTTGCGCTCGGTGCGCGACTTCGCACCGAGCTATTTCGACGACGTGTTCATT
CACAGCCGGGCTGTGAATGGGAAATCGGATGTGGAGATGCATACAGAGCATCTCCGCAAGTTGCTTGAGCTCATGCGAAAGCACAAGCTCTACGCGAACC
TGAAGAAGTGTATCTTCGGGGCGACCGAGATACCCGTACTTGGGTGTCTCGTGGGGAAGAACGGCGTACGCCCTGACCCAGGAAAGGTCAGAGTGATCAA
TGAATGGCCTACGCCTTCAAACGTAAAGGAACTGCGGCAGTTCCTTGGACTCGCCACGTACTTGTGCAAGTACGTGAGCAACTACGCGGGCAAGATTCGC
CCGCTGTCGCAGCTCTTAAAGAAAGAGGCTGCATGGGAATGGACTGCTGATTGTCAGCAGGCCTTCGAAGCAGTCAAGCAGGGCTTGACTGAGGCGCCGA
TCTTGGCGGTGGCCGACCAAGATCGCCCATTCCACGTTGTGTGCGATGCATCCGATTTCGCGATCGGATGCGCACTGATGCAACTCGATCACGAAGGTCG
TGATCGTGTGGTTTACTACCAATCGCGTCAGCTGAAGCCAGCTGAGCGCAATTACCCGGTACATGACAAGGAACTCCTTGCCATGAAGTATGCACTCGCA
AAGTTTCGAGTGTATTACTTGGGAGTAGACCATTCGTGGTCTACACCGACCACGCATCGTTGCGTACGGCGATCAAGTCGCCGCACATATCACAAAGAAT
GGCACGGTGGCTGTCATTCTTTGCTGAATACAACTTCCAGGTTGAGTACAAACCTGGAAGGTTGAATGTCGTGGCCGACGCGCTTTCGCGTCGACCAGAT
TATGCGGTGCAAGAGGCCGACGCCAACGCAGTTGGCGTCGTCAGGACGACTACACCCTCGTCGTCCTTGTGGACGACGTGAAGGCCGCATACGCACATGA
TGCGGATGCGAAGCAATTGTTGGAGTACTTCTCCACACCTTCTGACAAGTCTCGTCAGAAGCTGGCCAAACACCTTCGTGCCCGTGTACACCGTTATCGT
GTACACAATGGTCTGCTGCTTTACAGCGCAGTCGACGACAACGCAGATCGCATTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTACGAGT
ACCACGATGCCCCGACATCGGGACATCCTGGCCGTGAGAAGACATATTTGCTTCTCACGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAA
GTACGTTCGTGCTTGCGAGGTATGCCAGCGCGTGAAGCCTGCGCCCAACTCGCAGGCTCCGCTTCAATCACTACCGACTCCGTCGGAGTGCTGGCAGTCC
ATTTCAATGGACTTTGTTTTTGGTCTTCCGCAAGACAACAAGCGGAGGACTGGTATTGTGGTCTTTGTTGACCGCTTCAGCAAGATGGTGCATCTTGCTG
CAGTACCAGCCGAGGTGACAGCCAAACAGACGGCATGTCTGTTTGTCGACATGGTGTTTAGACACCATGGTATGCCACTCGACATCGTGTCGGATCGGGA
TCCGCGCTTTACAGCGCGATTCTGGCAAGAAGTGTTTACACTTCTTGGGACGCAGTTGTCCATGTCGACTGCGGATCACCCGCAGACCGACGGACAAACA
GAGCGTGTCAACCGCGTGCTGGTTGACACCATGAAGAGCTACGCGCACTCGTTCCATCAATGGAGCGACTGCTTGCCGATGGCGGAGTTCGCCATCAACA
ACTCGGTGCATGTCTCGACAGGACACACACCGTTCTACGTGAATGCCATGAGGCACCCACGCGTACCGAGCGTACTCGGTGCGGTAGCTCCTTCCTTAAG
TGGGGGAGGATATCCGGTTAATTCAAAACAACCGGATAAGCACGCTGATACAAGCAATGTATCAGCTGTGACGACTCGCGCACGTACTGCGCGCAGTCAT
GGCGACAACAAGACAGTGTCTACGACGGGCGTAGACACTTTAAACGACAACGAACATCACGCGCAGGCCGGGCCTGCTGCGAACAAGGAGCACGAACTGA
ACCAGGGGTTCAGCTCGGATGCAATGGACTTTGTCCAGCGTCGACAAGCCGTAATTCGGTTTGTCCAAGATGCAATAGCAGCTTCTGTCGATCGACAGAA
GCTGAATGCCGATAACACGGCAGGGGAAACACAAATGAATTCAAAGTTGGTTCATTAGTTCTGTTAGCTACGCAGAACCTAGCTAAACATGCAGTTTCCG
ATTTCGGAGCAAGCAAGCTTGCTCCGCGCTTCATTGGGCCATTCACCGTGTTGGCGAAGCATGGCAACGCGTACACACTGGACATACCGTCCAGCATGCG
CTTGCACCCAACGTTTTACGTTGGGCGACTGAAGCCGTACGTGCAGCACGAGTCACCTACGTCTGGTGACTCGCCAAAGCGCTCTCGAGCGCGGCGACGC
GCTTCGAGACGCCAGAGAGCCTCGTCCCGACCTCGACCTTTACGTTCGAGGTCGTCTGCGCAACCTCCGCGAGCTGAGCCTTCAACAAGCTCAGCTCCTG
ACGCAGAGCAGCGAACTGCGACGCTTGGAGACGCTCAACAGCCTCCAAGCGAGACTCAAGTTTGGTTGACCAAACCCGGGGCGTCTTCCCGCCCCCCCAC
CCCCGTTGCGAGACGCACGCGGGGCAACTCGCTGGATCGTCCAGCGAATTGTTGGTCATCGGAACCAGACCCGAGGTCCGGTTCATTTTCGTATTCGTTG
GAGAGGATTTCCTCCCCAACACGATACGTGGGAATCACGGAATGTCCTGATGGAGGACATTCCGGAAATGGTGACGGCGTACGAAGGCCGCCACCGCCAC
CTCCGCCGAAGGGCGTAAAACTTGGGCGAGCGCTGTAGTCGCCTACAGCACTCGGATAAGTGCTGCGATTATCCGCAGCACTAGAAGACGCCTGCGCCTG
AAAACTGGCGCGCAGGGTCTTGAGGTCGTCAGGTACACACATGGACGTGTACCCGTTGACGTCCCGCTCGGTGATGCGTACTGCTCCGGGTAGCAGTACT
CACAAGCAGTGTCATAAGGCACTGCGCAAGGAAGTCCAATACCGACTGCACCATGGTGCAGTCGTTCAAGTTTACCACGCTTCGAGAACTTCTCGTAGCG
CTCCCGCGCCTGGCTAATCCGGTCGCGATAGCCAGCGGGGTTCTTGTTGAAGTTTTCAACAAAGGCACTCCAACTTTGACAAAGTGCCTGCCACTCGGGC
ACTTTGCTTCTGCGAGAAGTCTTCTTGCTCGCAAACCATCGGAGCTCATGGAAGAGCCCGATGTAGTAGTCGCGCCTTTGATTCGTTAACGGATCAAAGT
GTACTCGCTTCGCGACGTCATCGTCAACGATGGCGTTGCACGAATACAGCGCGTACAGATTCGGTGGCGCGGTCGCACCGAATCGGCTGCCGATCTCAGA
CTGAGACGGCATCCACGGCTCGCGCACTGGCTCAGTGCGCGAGGCCGCAACAACAGCGGATGGAGCAGAGTCATCTCCATCCCGCGGAGTCGTAAGGCTC
CAGCGGCAGCGAGCGGTGTTCCACTGCCGCTGCGCGAACGCTTCGAGCTCGAAGCGTTCGGGTCGTCCTCGCGTGGACGACGCAGACCCACATTGGGGTC
AGTGTGGCCCGGAGACAAGGTCCTTGTCTCCTTCGAGTTCCCCCTCCTCGACTTCGCTTCCGTAGTCGAGGGGAACTCCCTCTCCACCCGGAGAGTAGAT
ACCCACTCCGGTTTCGACAGCAATGATCTTGCCTGTCTTGTTTCGGATGGCATGTTTCTCATGCCATCTCGAGTGGTATCCAGCAACAGAGAGGCGACTC
TCTGTTGCCGCGCTTGTCGGCATCGCCGTCGAGGCGATGCCAGTAGCGGTCGTGGCTGAGGCAGCGGCCGTCGTCGCCTTGGAGGCGACGACAGCACTTG
CTGTTGCCGAAGCGGCCGGCGTCTTGGACGAAGACGTCGTTGGCGTGCTCATTGGGAATGAGCACGTGTTCTCCCGAAGAAAATACGGATTGACGTGTCG
AGACCGGCACGTCAAATCCTAACGGGGGGATGGTGTAGCGGGGCTACACATTCGGTTCACCTCCTACCTTAGTGCAACATGCACTAAGGCATACATTCAG
GTGACCACCACAGGGTGGTCCACATTCATAGCAAAAGGCATATGACTGGTAGAAAGTAACACCTTTCTACCAATGAGAGTCATTCAATAGATAGGGGTTC
TGCCAGCCATCCAATGGCAGAACCTCTCATTAGAAATATCAGTTTTAGGAGGAAACCCCATTTACAATCAATACAGTTCTCATTTACCACCAAAGCTTCG
TTTGGTTCATTTATCTAGGTTTAAGTATACTTGTGGATACAAGTATACTGAACTTAAGTAAATTACTCCTACGCTTCCTCCTACACGTGCGCACACGTGT
AAGCTTAAGTAGTGGGTCTAAGCAGACCCATTACAACAACTGCTAGTCAGTCACCTCGAATAGCAAGGGAATATGAAATGGGCAAACACCAGCACGCTAG
TGACCCAACTAGAATATGAAATAGGTGGGTCAACCCAGGGTGCCGGAGCGCCTCTGGTCACCACCTAACTGGACTTGATGTTATGAGGTGGAGATGCCAC
AGACGACCCGTCCTTAATGGTCGCAGCGCCCCTTGTTGTATCGCGGTCGTAGTCTCGGGTCCTCCGGATTTCCGTCGGCAGGCTTGGCCGAATTCACTTG
CGCAGAACGGGGTAAAACAAACTCTGTTGTTGACTGTAATCCTTAAACTATCAATTCTTTCTAGATCTCGGCTCTGGGTGATTTATCTTGATTTCACTAT
GGCTTGGGTCAAATTGTCTTTGCTTCAGTATGGTCTGGGTACATTGTCTTCGTAGCTTCAAAAGTGTCGACTCAACAGTTCTGCTGGGTTCTTTGGCGGT
AGTTCAATTTGCGTTTCACTTGATGACGTACCACTGTCTTCGAAGTCAAATAGTCAGTGGTCAACCGTAGATTCTGGGTATTTGGAGTCAGGATTCAGGA
TTCAGGATGTACTTGACATCCAGACTCTTTGGGCTTCCAGCGCACGACTTGGGTGTTGGTAGTGGATGATCTTGGTTCAGTATCTTTAGTAGTCGCTCTG
AACCACAGCAAGATGAGGTACAATCTGAGATACGTTCTCAACTGCACTTTCCGCCAGGCTTTAGGCACTCATCGTAAGGGAAAGTCCGGGGGCTGGACAT
AATGCGGGTTTGCAATCGTGGATTTGTACACATCCAGGATACACACTTCCAGCCAGTTGGGCCCATCTGTGGTTAGGCGTAAGATCTTTCCATAAATCAG
TCGCACTCCATACGTCACCCGTGTCGCACGGGTACAGCCGAGTCACATTCTTCATTTCATCCAATAGTATCCATGCTCGAAATTTTAGACCAGAGTCGCG
ACGGCGGTGCGTCACAGAAAAACCAGGAACACTCGTGTCAACCGCCCCTCCTGGTCCAGATCCATCAGAGAGGAAATATCCCCGAGCTGGCGAATCATGG
CCAGGACATTCAAACGGGAGCCAACCCAAGAAATCGAATCAAACGCTGCCGTTGCACTCTGCCGTCTGCCAGAATTCAGCACATTGCCGTACCCTGTCTC
TCCAACGGTCGGTCACGATCCATCTTAATGTTCTCCTCCCGGATACCACAGCATTCACGTGCAATACGCGGTCATATCGCGATTTCCCAACTTGTCAACA
TGGCGGAGACCAGCAACATTCCGGCCCCAGCGCCTTCCTCGACGCCAGCGGCGGCCAGTACACAGCCTCCTCCAGCTTCTGCTTCTCCTCCAGGCAACGG
CGACGTCGAGATGCGCCCCCCAGAAGACTCGAGCCAGCTTTCAGGCGCTGAATCGCAAGCGATCGTTCCTGCGTCAGCCCGAGGGTGACAACAGCACTGA
GAACGCCCCGGACGCGAGCGCAAACGCTGGTGGCGGTGGCGTTAGCCCCATCCCGATGGGCGAGGGTGTCGTGTTGCCTTCCTTCTCGCGACCACGCCAC
GTGCGGATGGAAGACGTCGACGCGCTATTTTACAAGGGCGTCCTGTCACAGCAAACGTTCGGCGCGAGACTTTTGCGCCTCCTGACTCTTCGGCGCGCTG
GACCTTGCCTTCCCTGCCAGACACCAAGTACTTGGTGGGAGTTCCAGCCACGGTGGACGACACGCGCGGCGCGGCTTCACGATGAATGGTATGGAGGCAC
TACAGCATTGATTGGCTTCGAGGAGATGAACGCGGACGACAATTCTGAATTCGAGCGTCTGTTTGACATGAGCGCCCGTCAATTTCTCCTGCAAGCGCGC
AAGACCCACTCCGGCTGGATGCCTTGACCTCCAGTCTGGACGACATTGGCACGCGACGTGAATTCGCCTCGATCCTGACTCATTTCCTCCGGATCACTCG
CCTCACGTGTCTTCCGCACTTCGATGTATTTGCGTATCGCTCTGGGTGAACCAATTACTGCTAGAGCAGCCAGCTTGGTACAGTAGGTGATGAAAAGTTA
CGCACTACGCACACTCAACTCTTGAAAAAGAGTAATATCTGTGCAGGTTCGCCAACAGTACGGCGATCGCTGGTGCAGGTATCGGGCTTCGCTACTTCAT
GCAATTCGCTAGCATGTCGGACACTCTTGTCCTCTCTCACACACGGATGGCTGACGCCGATAGATTTCAAGTGGGACCTGATATCTTACGGGATCTGGTT
CAAGATCTGCCGTCTTACGTCATCACGCCAGTCGGACGAACAGCCAATCAAGTGCCATGATCGTCAGAAAAGCGGTGGAAACCGTTTTTAGCTCAATCAG
AAAAATGACCAGCTGCCAGGTGCGGTCGTACCGTGGCGTATGAAAGGGGGCAAAATGCCCCTTTCATCATAACTTCGCGACCAAGCCCTCCTAAATCCCA
TCCTCCTTCCACTATCCAGAAAGGACTATTTCTAGGCGAGTACCGTGGTTTATGAAAGGGGACAACATGCTCCGTTTCGCTGCTTAACATCTTGACTTGT
ATGGTATAGTTTGATTGAGTGAAAACCGCGAGTTTTCCCGCCTGCACGAAAGGGTTAAGTACTGTCGCACATATGGAGGAGGTCCAGTGCCGATCCCCAT
GCACAATACATCAACTTGGAAAATGTATGCTTTGAATCACATTCTGATTGGCGTAAAATTTGACAAAATGTTTCGATTTGACTGGCCGTGCAATCCGGTT
TTGCATATTTTATTGCTTCGGGCTGGGAAAATTGCTTCTGACACCGTTTCAATACAAACCTCAAGTAAGTCGGAAGCAGCTTCAATTTTCTATGATTTGC
AAAGCATACAGCAATATTTTCAGGGCTAGGTGAACCAATAAATACTAGGATCTTTTTATAAACCTAACCCTTCATTTTGCAAGTGGTAGCGCTACTTCTT
TGCAAGATGATGTCCCTGGACGATGGCGAGCAGCAGCCGCTCAAGACCAACGTCCAGCAGCTTCAGGACACCCGCGTCTCTCGGCCACGACAGCTGCGAC
TCCAGCGACAGCGCGTGGTCACGTTTCTGGCCTTCGTGGGCTTTGGCCTCGCGTCATGGATCATGACAAACGTAACGTACGTGGAGCTGGGCGTGTTCCT
GCGCGAGTTACCGGAGCACTACAGTATCTACGCCTACTCGGTACAGTCAAAGCGGACAGGATGAAAGGACACATGACGGGTTGACTCATAATTGCTGACA
ATTATTGCCTGCAGATCCTCGCACTCGAGTCGGCCAACATCTACCCGATGCTCTACATGATTTTCAATGCTCGGCAGCAATTGCTGAGCCAGTCCACCGT
TATTTGGTGGATTTTGGTGCAAGGCGTGGTGGTAGCGGTGCTCATGAGTCTCTTGTGGGACCAAACGGCCAATGTATTTGGATCGAGACACAGTGTCGGT
ACGCTGCCCTGCAGTGCTGTGCAGTTGCTGCCAGTGGTGGAGAGGACAAGAGTGCTGACTGTTTCGTTACTCCTGAGCTTATAGCGATGCTGGTCCTGAC
ACATTTCGGGGGCATGGTGAGCACGACGTCCAGTGTGGTGTTCTACCCGTTCGTGGCGAACTTCCCGCCGCTCTTTACGAGCGCGTTGTCCACGGGGGAG
GGGCTCAGTGGGTCTTTAGCGGCGTTGCTGGGCATTGTGCAAGACCCTGGGGGTGTCTTGCGCTACTCCGTGTCGACATTCTACCTTATTTGTGGTGGGT
GGAGTTGGATTTTAAGGTTGTGGTGGCTTTCGGTGAAGGGTACTGAGACCGATAGTGCTTTGTGGCAGCTACGATTATGAGCGTGTCGCTCGCTGCGTTT
GCGTATTTGCAGTACCATCCGTGGGCACAAGCGGTGCAGGCTTCAGAAGAGATGGAGGCTGCGACAAATGGGTCGGTACAGGACCAGAAGCAACGCGCCT
TGGAACTGGATGAACGGGCTGCGCAAGAAGCAGAGGAGGACACGCTGCTCAGTCGGAGCTCCTGCGGTAGCTGTCCCAGCTCCACGAGTGCAAGTACCGT
CACGATTCCTGCACCGACGGAGCTGGAAAGCGCTGAAATGATGTCTGGGGCCGCGGTATTTCGACAGGTATGGCCATTGTTGGCTTGCCAGTGGGTGCTG
GCCGCCTTTTCTTTGGGTGGCTACCATCTACGATGCCCTATGTGTACAAGAAGTTTGCGGTGCGTCGAACGAACTGTCAAAAAGCGACTGCTGTACTCAG
TCAGCTTCATCTGATGATGTTTGTTCCGTAGCCGGCAGACAATACAGAGACGATGACAGCACGTTTCCAGACTACAGCCAGTATTGCAGCGCTAATTCTT
TCTCCACTTGCTAGTGTGGCCACAACGTAAGTACCCATTTCAGAAGGTGTCTAAGGAATTGCTAACTTTGTGATACGTTGTACGGAAAGGTGGGTGCGGT
TGTATTACGTCCAGAGTATGACTCTCGTGCTGGTAGTACTTGCGGTGGGTTTACTGCATTTTGGGGAAAGCGAGGTGTAAACTGACGAATGTACTTGCTG
TCATTCTGTCCCTCAGTCGCTGCTCCTGTCGTTCTCGCTCACCTCCAGACCGATCCTGAGTGATCTCAAGCATGGATATTTATTGCGTAAGCCATGTGTG
GGAACTCCCATTTTTGGATCGATGAGTATTGCATTAACAATCGTGCATGTGGCCCTATCCATTTGCGCAGCACTTCTCGTCCACATATTCTACCTCGTTG
GATGTGCGTACACGCAGACGATGCTCTATCTGACGCTGAAACGAGCTGGAGGTAGGCCGCAGAAAGCATTATCCTACAGTAGTGCAACGTATTGTTTGTT
GTTCCCAGTTTGGCTCACTCTTTTGTGTTATCATTGTAGACGTGAAGCACTCGACGGGTTTTGCGCGGCGAGTGTATCAATGGAATGGTTTGGCTACACA
GATGGGCGCTATGTCTGGAACTGCAATTGCATTTCCGCTGATTTCTGGTGCGAAAGTTTGTTTGTTCAGTAAGCTGCGTTGGTAAGCGACAAAAAACTCA
ATTCTGTAAACAATGTTTTCATGTTGGAAGTCCGCTCCGTCATCATGGCGGCCATTGCTCACAAAAATGGTTAGGACCGCCATTTACCTTTCCGATCGCT
TCGTCAACTTCAAGAATTCCAGGTAGTACTCATAGTCCGGGTCCGCTTTTCGCTCAGCTTTGGACAACCATCCAGCCCCAGCATTTCTTCCACGTACCAT
TTCTTTCGGTTCGCCTTGGCCCAAATCTGTACTTTCACATGCATCTCCGCTGGGCTGCCTCCATACTCAACCGGGGGCTGGAAAATGCTGTTCTGTGGTT
CCAAATCGCGTTATCGTACTTGGTTGCATAACGCGTATATTGTCTAAGCTCGTCGCTATTCTTGCGCTGCGCCTTGCTCATTCCTGCCAGCCCCAAATCG
CTCCACACATCTTTCGGTGACATTCCATCCTCAAACCAACCGTCCATATCACGACCTTCTCGTTTGTACCAGAACTTCTCCAGTTTCTTGTAGTTCGGGT
GGGCCTTCAAAGCAGCACCCGTCAGCCCGTCCATCTTCAGCGCCTTGATGACCTGCTCGTCAGACTTGTCGACTGCCAGCCAATACTGCATTTTCCCCCA
ATTCTTGATGGACGACCAGATGCCCCTCTCTTCCGTGTCGATGGCATTTGCCTTAGCAGTGTCAGTCTTTCGCAGTAGCCTTCCACGGTTGTATCCGACG
TCAGGAATGCTGCTGGATCGGGTAGACTTTTCCGCGGCCACGGTGATCGCGAGGAGGATCAACAGAGTTGCCAGGAAGGCATTGCAGAAACGCATGGGAG
GAAGGCGCCGATGCGAGGGTTACCTGGACAGTTGTGAAGTGAAGTCGATCGAGAGGAGAGAAATACCAACAACAAAAATGATTTGTCATTTCATAGAATA
GCGACGGTGATTTGCAAGGGCAGAATCATTAACATAGCTCGCCCGAGGAAACATATTATGATGGGACTTCTGGCTTCACCTTGTCCAGCGTGACTAAACA
CCAGTAGGTTCTACTGACTACTAGTATAATACATATTGGGAATAACTTCAATCCTGGCCCCCGGTGGCCCGGAGAACCACATCCTCATCGAATTTTGCTG
TGAGCACGTGTCGGCTCTTTCTCAGCGGTTTTGGCTGAGAAAGAGCCGACACGTGCTCACAGCAGAATTCGCCAGGAAGGCATTGCAGAGATACAGTCAC
GTCTCACTACATACAAGGTTTCTAGAGGACAGTAACCGAAACTCAAACTTCAAACTCAACTCGAGCGTGTTTTGGAACCCGTCAAAACTGCACATTAAAT
GTTAAAACTCACCAAGCTATGAGGAGGCCGAATTAACTTGGCCAGGAGCGTATGAGTCTACCCAGTAGAACCTACTGGTGTTTAGTCACGCTGGACAAGG
TGAAGCCAGAAGTCCCATCATAATATGTTTCCTCGGGCGAGCTATGTTAATGATTCTGCCCTTGCAGATCACCGTCGCTATTCTAAGAAATGACAAATCA
TTTTTGTTGTTTTTTTTTTTTTTTAGTTTTCAGTGAGGTACATTGATGTCACTTAGTGGTGCTAACGACTTCCTATGTCCGTTCTAACCATCGCCCCTAT
GTCGGTAGTTAGCCTTCTCCAGGTCCTAGCTTACGCTTCCCCGTTACGTGCCGGTGTCCTTACTGACTGTCGGCCACGACGTCCGCTTGCGCCGCGTTGT
CCTCGTGTGTTTTCCATTGTATATGTCTCCATCTAGGTGGCGGAGTACTTTCCTCCATTTCCCTGAATCGGTGCCCGTGTCAGCCGTGTACTGTTGTACG
CTCGTTCTGCTTTCGAGCGCTGTGTTTGTTAGCTCCATTGCCATACGGTTGGCTTCTTTGGTGTGGTGTAGCCATTCTACTTCCCGGAGCCGATCCACGA
TGCGCCGACTCCTCCAGTAGATTTTGTTAAATGCCGTGCCTTTGGGGGCTTGCGTTGCCGATGCTGTGCAATCAGCATCTTGTTCGTGCTCACCACCCAT
AGCGGCCAGTACCGCTTCTTCTCGCACGCCTTGAGTCCCATGAGGAGCCCTAAGTGTTCCGCTTCCGTGGTCGTCGGTGACGAGCTGGCGTATGACATGT
GCCCGCTCCAGTTGGCCCCGCTCGATATGTCATTACAGCTGACAATGATCGCCCCGCAAGCTCCTGATCGTTTTGTTCCTGCCACCCGTCCGGCCACGTA
CAGTATGTACCTGGTTCCTCCCTCGGCGTGATCCACTGCTGGCAGTGTGTCCCCTCCCGAGTGAAGGGCTCTACCGACGATCTTCGCCGCCGTCGCTCCA
ACTACTAGTGATGGCGCTGCCCGTAAGTGTGCCTGGACAGTATTGTAACCCTCTCGCAGCCGCTTTTAAGGAGTGCCACGTGGTGCCCTTCCGTGATGTT
GTTCGACTCGTCAAAGTGGTTGACCCGCCACCGCCAAGCTGCGTGGAGATAGATGGCACCCAATGCGCCAGCTGCTCTCAACGAGCAAAGTCACCTCCTC
CGCAATCTGAGGGCGCAAGTCCATCACTTCCCGTTGTACTGTAGCCATGCTGCCCCATACGCCTGCCGGTATTTTCGTAAGTTGCATCCCGAATACCTCC
TGCTGCAGTCCGTCGTCTGTCAGTCCGAGTTGTCGCCATGGCTGGAGTAGGTGCCTCCGTAATTTCGCGTCGCTGGGCATCCCCAGAAGACGTGTTCCAG
ATCCACGTCCAGCAAGTGTACACAGGATTCATGTGGGCAGCCGATCTTGTCGTGTCGCCTGTCAAACATCGAGAGTGCTCTGAGCTTGAGGCGCAGTAGT
AGTTGTTCTCCCCACGGATTGAGGCCCACTACTCTCCGGATGCGTTTCCATTCGAGTAGTGCAAGCCCTTCCGCCAGTTGTGGGCTCCGTTCCTGCCTTT
TTTGGTCCTGCCGTCGAGGTCTATAGCCCCTCGACGTCGTTTCGCCGCTGCCACGCGCTCTTTGTACTCACGGCGAGTCCGTGTCCACCTGCGGCGTCCC
GCCCATAAGCACACGAGTCTGCTCAGTCTTGGATGTGGGTGAACCTCATGCACCTTCAGTTCCGGTCGCATTCTGGCCGTTAGTACTCTGCATAAGTCTG
CCCCGCCGTGTATTGTCTGCACCCACGGTTCCTCAGTGATGGATGTGTGGAAGACCACTTCCACCGGGGAGTGGCCTCTGACCGTCACTATCACCGGGTG
TTGGTCTGGGGTAGCAGTGAACTTGACTTCGGCAGGGTATATCTTCCGCGTCAGCAGGTCCATATAGTTAAAGAGCAGTGCTTTCGCAAATTTCTCGGCC
TGCGCTCGGTTTTGCGGCGCACCATGCGCTGCGTTGAACGTGAAACATCCCTGCCCTGTGGCCGTCCTATTCCAGGCAGCGATGTCCACTACCGTCGGGG
TTCGCTCGCCTGTCAGTCCCATCTCCTCCGCCAGCGATCTGCGTTGCCCGTCACTCGAGATAATCTGTAGTGTCTGCACGTCCGCGTGTGCTAGCCACTC
CATGTGCGGTCGGTCCGCATATTTCCCGGAGGAAATTGTCTTGCAATCGCCATTGTCCGCAGCAGCTCCGTCGCGTCGACTCTCAGTGTGTGATTCTCCC
ACTCGATGGCGATACCACCCGCTTTGTAGGCGAGGCATACCTCAGCTCGTTTAGTCGCTAGCGCTGTCGCCGTCGGCTCCGGGAGTCCTGCCAGAGCTAT
CAACTTCCTACCTGTGAGCCAGATACTGGCGCTTCGTCGGACCCCTTGAGTTCCGATGGCGTATATTCAGGTGTGATGTGCACCTTCGGTGCGAGTCCTG
GCTTTCCAGTATGAAACAATACGTCCGACAATGTGTGCTTGGTGCGTCCCGACCGCCGCCCAGGTGCTGACCGCCACTGCCGCTAGCGCGTAGAGCTCCG
ATCGCAGATCCGGAACTGCGAGCCCTCCGTTGGTCGCGGCAGTGCTGCCAGATCTGCGTTTAGCCATGCCCTCGTCCCCAAAACTTCATCTGCGAACTGC
GCATGCCAGACATAGTTTCGTATCTTGGTGTCCATGAGCTGCACCTCTGATGTAGTCGGCCAGGCATGTCGTGCTACGTACAGGAGCTTCGGGATGATGA
CTGCAGCCGCAATCATGCTGCGTTGATCCACCGTCACACCTTTTGACTTGCCAGAAGCAGCCGCGTGAGCAATTGTTGTCCAGCTAGTTCCCAGGATCGG
CATGGTTTCACATTGCTTCCCACTTGGATGCCAAGATACCGACACGCCGTCGCTGCGCTCTGATACTTCAGTTCCTCTGGTAACTGCATGTGCGGCTGCG
GCCCGTCCGCCCGCAGGGCAATCACCATTGTCTTGCTGGTGTTGATCTGCAGGCCCGAAGCGTTCCCAAACTCCGCTAAGACCCTCAGCAGCACTGGAAC
GTCTTCAGGGTGCTTCACGAAAGCCGCTGTGTCATCCGCGTAACCTGCGACGCGTAGCTCAATTTGTCCCGCCGCTGATTGTACAATGACCCCCGTATAC
CGAGGAAACCATCCAGTTTGCGATATAATGATCCAGTGCAAGTATGAACAGCATGGTGCCAGTGGACATCCCTGGCGGATGCCGCTAGTCACTCGAACGC
TTCGCGAATTGAATCCATTCACCAGGAACTGCACTTGCGTTCCATCATGTAGTCGCTCTATCGCTTCACAAACTTGGGGGGTATCCTTCCGGTAGAGCAC
CTCCAGCATGTACGCTCGGTCGACGTGAGTCGTAGGCCTTTTTAAAGTCCAAGAGAATTGCAGTAGCGTCTTTTGGCTAGGATCTGCGACCACCATGCGT
TGTGCGGCCTTATAGAGGTCCAGCGTCTCATGGATGGTTCTGCCCGGGACAAATCCGTTTTGATTGGGGTGAATTTCATCCGGCAACGTGATGCCATTCG
ACTTGCCAGGACCCTGGTGAAGATCTTGTAGTCAGTGTGAGTAATGCCAGCGGTCTGTAGTTCAGCGCATTGCGTTGCGAGCCGCCCTTCTTCAGGCAGA
AGATGTCGGCTTCGAGGAAAGTCTTTGAAAGACCCCAGCGTCGTCCACAGATTGAGTAGTTGGACGAGTAGCAGGACCAGAAGATCTTCGTATTCGCGAT
ACCACCCGTTGCCAGGCGGTCGGGCCCGCAGCTTGCAAGTTGCATGCCCTAGTGCCGTCCGCACCTCCGCCTCTGTAATGACCGCGGCAGCGGCCTGTTG
CTCCACCGTCGGTTCTCCTTTGGGTGGAATCCACTCCAGCACTTTCTCGATATTCGCTTGGGTGGCTGCGGGCTGTTGAAAGATGGATTGCCAGCCGTCC
GCCATGATTCATGTTTCTCGTGTAATTCTCTCGGTGGCGCCCCGGCACCTCGTCCAGTTTGTGAATGATATTATCAGCAAATTTGGTCGAAACTCTCCTG
AAAATAGCCTGGTCGTTTTCCCTGTCCAATGCGTGTTGTCACGGAACAGCCGGCGTTGCCCCAGATCAGCCCGGACTTTTTGCACTCCGCGATGGCCCTG
CGTAGCCGCGCCTCGCGCGTTGTGCCAGCCACTTCGTCAAGCGAAATGCGTCGAGCTCGTCTGTCACGGCTTCTATCGTTACTGGGCGCCCCAGTGTGGC
CTCCAGCAAGCGTTGTTGCTGCCGTATCAGCCTTGCCAGCTTCTGCTTGGTGGAATTGCGGAGCGACTTCTTCCGCTCTCTCACGTAGAGTCGTGTTCGC
CTCGCAACCTCCGCCTTGACTGCATCCCATCTTTTTGCAGCCTCCCGCCTCCCACCGTTGTTCCAGTAGTTGTTCTTTAAATTCCTCCAAGCTGCGTTAT
CACGCATTCACCGCCTTGAGCGCATAGCCGGTGGTGGGTGAACCCTTGATGGTCGCCGAATCCTGATTGGGTCAATCGGCGATCTAACATGCTGTTTGGT
ACCCTGGTGGTCCCCGTCCGCCCCGAGGTGGACCAGGTTCCATCCTGCCGCCCAAGGCATTGTCGCCGCTGTGACGTACCACTTGTCGACTGGAAGAGGC
CCCGCCCTTCCCGGGGATCGTGTAGTGGTAAGTGTGCGTCACCGCCTGATGTTTCAATAAGTCTGCTGGTTCCCACGTGACCGGTCGTGCCAGTGCCACC
GGGTCCAGCATCCCCACGCCATCAATCTTCTCCGCAACGCAGGCGAGTCGTGGCCTCCAGCACCAGTCACATAGCTTCTGTCTGCAACTTCATCCAGATG
CAGTTGAAGTCCCCCCCCCATGAACACCAGCTCATCCTTCGGGAATTCAATAGTGCTGAGGCTGTCGAAGAACGTTTCCCGGGGCGCGAGCAGTGTGGAG
CATACACATTGCATATGATCGTTGGCTTCCGTCGAATGTCCCCCTGACAGCGATGAAGTGTGATGACCAGTGCTGCGGCAGGTAGGGCATGACGTTCTTG
AACGATATGTAAGGGTCAACTAGAAGCGCAACCCCCCTTTCGATCTGTCGAGGCGCCCAAAATGAGTGGACCTGTTGGTCCGGGTCGCTTCGGAATCCCC
ACCTTGCAGCGTAGTGCCCTTCATACCGCTGCACTTCGTCTGCCTCCACGTGCGTCTCTTGGATTGCCAGCACGTCGGTGCGTCCGTGTGCATCGTGTTC
GCCAAACGCTTGAAACCAATGTATTCTCGCCGCCTCCGTTGCCCCCAAGCCATTGACATTTTGTGACGTAAGCCCAAACGTTTGGTCAGACTCCAGCAAC
CCGTGCTCTTCCGGGTTCCTGCCGTGCGTCGTTGGCTCATTTTCCGTTTCTTCACTCGCTTTCGCTTGTCGTTCCGGAAGCGGGCGTGTATGTCACTCCT
CTTCTACTCCTCCGTCAACATTCTGTAGTATGCCGGTATGCCAGTTTGTCTGCTATCCCTGTCAGTTTGGCGCTCCTCATTCCTGGTATCGCGCGGCTCC
GTCTTCTTCTTCACCTCTTTCCTCGCCTTCTCCTCCGTCTCTTCCTTCTCCCTCTGCTCCCCAGTTTCCTTTGGGGAAAATGGACTATTGGCTGACAGTC
GACAAGTCTGACGAGCAGGTCATCAAGGCGCTGAAGATGGACGGGCTGACGGGTACTGCGTTGAAGGCCCACCCGAATTACAAGCAACTGGAGAAGTTCA
TGTACAAGCGCGAAGGTCAGCAGATGGACAATTGGCTTGCGGAAGGAATGTCAACGAAAGACGTGTGGAACGATTTGGGGCTGGCAGGAATGAGCAAGGC
GCAACGCAAGAATAGCGACGAGCTCAGAGCGTATGTGCGTTATGCAACCAAGTACGACGATGAGTGTTGGAATTACAAGAACACCGTGTTGGAGCCCCCG
ATTGAGTATGGAGGCAGCCCAGCGAGATGAAGGTGAAAGTACAGATTTGGGCCAAGGCGAATCGAGAGAAATGGTACGTGAAGGAAATGCTGGGGCTAGA
TGGTATGTCCACAGTTAAGCGAGAAGCGAACCCGAACAACAAGTACTACCTGGAATTCTTGGATTTGACGAAGCGATCAGAAAGGTAAATGGCGGTCCTA
ACCATTTTTGTGAGCAATGGCCGCCATGATGACGAAGTGGCTTGGGAATATACTTCAATCCTATCCACTGAATGTTGCTGCAGCTGAAATCTCTTCTACA
TATTTGCTTAAGCTCGATCTTGAGTTTCATTGCTTCGTGTTATCCACTGCGGATCTCTCACCCTGTTACTGAACGTCCAACAGCATTAGTACACCGGCGT
CTTTCGATCGTGGCAGCTATTCCTCCAGCGGCAGCGCATGGCCACATTTCTCAATTATCTCATGCGCAAGTCGTTAGCGTATAGAGTTAAGTCACTGAAA
ACGGAAACAATCAGTGGATTCTGCCTACGAATATGGCCGGTCGCCTCCTTAACAGGGGAGGGATAACGGCGCTCTACTTTGGTAATTATTTTTCCTTTAG
AAATTAATGGTAATTATCTTTTTCCAATAGAAGCCTGATAGTATTGAGACGTCCTAACGAGAGTCCGTCTGTCGGGGTTGTGCTGTGGCTTTGCCTCTTG
TGAGGCCGACCAAGGCTGTTGTCAGTTAGGTCTGGGTCGGGCTAGGTGTGCTGTCGCTTGGAAATGCTTACTGTTAAGGTCTTCGAAGTTTCGCTGCAGC
ACGAGATGACCGTAATGGCTTGACCATTGAACTGCAAATAATTTGTCAAGAGCGTTGTCCGTCGGTGGAATCTCAGTCTTTCTGAGTGGAGCGGACTCAA
GACTTTCAACTTGGCGAAGTATCTTGGCCGGGTCTGCCGTCCTAGCAATAATTCCCAGCCCTGGTTCAGGAGATATGTCGTGGTATCATTTCGCGTCTTT
TGTGTATCGAGAATGAGGCTGCCGGCTGCATCTGCGGAAGGCCCACCGGCTGGGCTCAGGAGGAGATCGGCAGGTTGAAGACCGCCTCGTGGGTTCGGTA
CTTCAACCTTGTTCGTAAGCTAGCTGCGAGTAGTTTTACAGGCAGACTCACAGGCTAAAATTCAATTCAGTTTCGAATTTGCTCTCCGAGGAACAGTCCG
TTGTAGACACGGTCAACCATTTCAACCCGATTGTTGCCATGCCATTGTGGCGTTGGGTTTTGGAGCCGAACAGTCAAGGTCCGGCGGACGTTGCACCTTT
CAGTGAACGGCGACAGAGTGTCTTGATTGGCGGGTCTCATTTCCCGCGCTATAGTGACCTAGGAACAATAGTGACCGAGGTCTCGGCTGGGTCTAATAAA
ACCCCGGCCGAGGTTAAAAGCCTCGTTTGTACCCATTTCGTGTCGTACCCTCGGCTGTGTAGAGCCGGCTATACGATTTCCCACAGAGATCTGTTTACAC
TTGATATTTGTATAGAGATATAGGACTAGCCAAATGATGACCTACAGAGGCTCCCAGAGCTGTAGGATAAGAGAAATAAATCAGCAGTCTTCCCCACAAG
CCACCAAGGGTCAAGTCCGTCTTCGGTAAGTCTAGCTAGCTTGTCTTAGGGTCTGGATACGCTCGGCTGCGTGGGATGCCTGTCAGCGAGCTTGAGGTAC
ATTGAACCGAGAGTTTGTTGCTGGTCAGTCCAAGAGATAGGAGTGGCCGAGAGTTAGGGGCGACAAGGAGTGTCGGTCCCTATATATTGGTGGAACCCGA
GTGTTCCCAAGTGTATTTCACTACCCGCCGAGGTTACCCTCGGCAAACCCGTATTAGGCGTGACTGCCGGTACCCTTACTTCTGAGGGACTGCGGGGGTT
CGCGCGAAAGCGCAATATTGCATTCTAGCCCTCGCTCGTGGCTAGTAGTGCAGGTTTTAAGGTTGACCGAACTCAACCTTGGTATACAGAGGCGCTTACA
ACCAACCCGGTGTAAGGGATCGTTCCTGGTCTTCAGGTGTTGATCCAACGTTCGCTGACCTTTCGCGAGGGAAGCGTGTGTTGTTGGTGGGACTCATACC
GTTCGGTAGTGAGATTTTCTGCGTGTTCCTACACGACAACTGGTGCCGCGACCCGGGATTGGTGTGACCTTCTGTGTGTCTTGGTTGCATATAGGTTCTT
ACCTTAACGAGCATTCGAGAGAAAAAGAGAGAAGAAGAAAGAAGATGGCGAAAGAAGCGAAGTCAGCGGTACCAGCAACGCCGGCGAGGTCAAGTGGAAC
GCGTACCGAGGGTTCGGGGCGTTCCGGTTCGTCGTTCGCGACGCCGAGTACGTTGGCGTCGATCAACGAGCGTTCGGACAGTTTTGATGAGCCGATGGAC
TATTCTGACGCCAAGGAAGATAGAAGATGACCTGGAAGAGAAGGCAGCTATGCCCGAGCTTTCGGAAGCCGCTGCAGTATCTGCAGGACGCAGCGAGGGG
TGAGGTCGCTTGCGCGAAACCTCACCGAAGAGTTGAACGAAGTGGCTGGTCCCGAACCAGCCAACGGTTACGACGAAGATGAGTCCGACGATCACCGATC
GTCGGCGATGGCCGAGGATGCGAATTCTCGGCCGAATGGCGGCCGGCCTCCTCTTAACGGAGACACCCCGGCCGCCAACCGAGTTCTGGGTCGATACCTA
GAACTCATGAAGGTGAAGAGCAACTGGATGCGATCCTTCGCTCCAGAGGTTGTTCGCCAAGCCATCTGGATGGAGCTCGGTGGCGAGTTAACTGTGCCCG
TGGAGTCGTGGAATACTCGGCAGGTGGCCGAGGACACGGTGCAACTCCTACGCGCTATGGGATGTGAACCCCAAGTGTTCCCGTCGGAAGCAGACCTCCG
AGCATGGGCACCCGAGGACGCCGCTACGGCGCTTCGCAAGTGGAAGCAGAAGCTTCGGTCGGCCTTCGGGGTGGCCGAGGCGGGAGTTAGCCGTCCACCG
AACGTCCGCCACGCATCGGATCCGGTCGACCCGTCCATGATTCCGTTGCCAGTGACCCCTGGGAGACGCCCCAGAGGGTCGACCGAGGCCGGAATATTTT
CGGCCCAAGGTGCGACGTCGACATTTCCAAGACTCTCACATGGTGACGCCGAGGTCGGTCAGTCGTACAGAACGACTGGCGAGAGAGGCCGAGGGATATC
GAACCGCTCCGACTGCTGGACGAAGCGCAAGTCGGACGCCCAGCCGACGTTACGACCTCCGCGATGACTCATCTGACGAAGATTCGTTCGACGTCGGAGA
CACCGGGGGTGACTTGACGGGAGAATGGGCACGCCAAATTCGTGAGCTGAGCGCTGTGGAGAATGACAGTGCGACACCGAGGCTAGAGATCGCTACGCAT
CTCCCACTCGGAAACATCAAGCCGTACTTGGGACTCCGCGATAAGAGCGAGAAGTCCATGCAGTGGCTCCGAGCGTTCATATACGAGATGAAAGGGACGC
ACACGCCGCCCAACGAATGGTGCATGGCGTTTGAATTGAGCCTCCAAGATGGTGCTCTGCATTGGTACCGACAGCTGCCCCGCAAAACGAGCGCACGTGG
AAATTGTTGAGCGATGCGTTCATTAAGTACTACTGTTCGAGGTTCAACCAGTCTGCGAAGGCTCGGTACTACTCGGCCAAGCGAGAGGAGAAGGAGCATG
TCTGCGACTACCTCAACCGACTTAACGGCTATGCTCGCAACGCCGGAGTGCAGTTCGAGCATGGCGGTCGTGATGCAAAGGACCACGTCGAGCATTTCTT
GGATTCGTGCGAAGACCGAGGTCTAGAAGAGCGTCTGTGCCATGTCCGAGTTAAGAACATTCACGACCTCGAGGATATGATCAATGATATCCTTCGTCGC
AGAGAGCGAAAATCTGGACGCGAGTCCTCGGTCCGCCGCCCTCGAGGGCAAGAGGTAGCACGCCGACGCGATGGTGGACGCTCCGAGGATCCGCGGGACG
GCTATCGCCGAGACCGACGTCACCGAGAGGACGACCGTCGTCGAGAAGACCGTTACCGAGACGATAACCGTCGCCGGGATGACCAACAATATCGACCGAG
GGTCACTCTCACTGACGCACTGACCAACATAGTGACAGCACTGAATGCGGGACGCTCGGGACGCGCGTGGAGGATACCCGGAAGCGTACAACGACGGATA
TGATGACACCGAGGAGTATGGGCCGGAGTCTCACTCTGGCGATGACGACCGATACTCCGAAGGGTACTCGGACGACGGATACGCGTCGACCGAGGACCGA
GGCCACGTGGCTGCTGCAAACGACTCTGAACGTCGCAATGCGGCTGAAGGAACGTTCGCTCGCGCCGACAACCGTCGGCCGAGGGCAAGTAACGGCCAAC
GCCCGTATGACCGAGACGACCAGCGCCGAAACTCCACCGGACGCGATGGTCGACGCCAATATGGTCCATGCGCCGCCTGCGGAGGACTCACCCATTCGGC
TCACTACTGCTTTAAGCGATGCAAGATGTGCAAACAGGTTCATGATGCCGGGAAGTGTGAAGCCTTCCAAGAACTCACGAATCTCCTCCGAGCTAAGGTC
GAGAAGAAGGACCTCTCGCCGGAATTGCAGGAACTCGTCTATGGGAGTCATTTAAACTAGGCAGCCCGCCAACTGAAACTGGGTTGGTCCCAATCGGGCT
GCCACAGTTAGCCAAACCTGCGCTGGATGCGGACTATATGTTCGCATTCGCAGGTGTGAGCAAACGGCCTGATGACTTGAATATGGAATATGTGAAAACG
ACGGAAAATGTAAAGGAGAGAGGCGTAAGCCTCGGTGAGAGTGAAGTGAATGGACGACGTGTGGACGGAGACGGAGTGGAGCTAACCGATGCTTCGATCC
TCAGCATGGCCAAAATCGACCATCCATCCCGAGACCTCGGCCAGACGATTAAACTGTTATCTGGCGAGAGAATGGGGTGGTGGTCATCCCAGCGCTATGA
CAAGAGGAAGCGATTGCGAGCCCTCGTCAATGGGGCTGTAAACGACTCGCGAACGAGGATTCTGCTGGACACTGGAGCGAATGTCAGTGTGATTTCCGCG
TCATACGCGAAACGGTTGCGCTTGCGCGAAGTTCCAGACCACGGTAGGAGTCTGGAAGTGCGAGGAATTAACCCAGGGGTGATGGAGACCCGCAGACGAG
CACTCGTTAAAGTCACGCTAGGCTGGGAGCGCGTGTACGAATTTGAAGTATGGGTTATGGATCACAGTGCAGGAGTGGACGTGGTCCTGGGAACAGACTT
CATGATTCCAGCCGGAGTCCGGTTGGATCTGTTCCACGGTACTGCGAGACTACCGGACGAGGTAATGGTGCCCCTGGTGAAGTCGCAGAACCCAGCAGAG
GCCGAGCCGTACAGCATGCAAGTGACTGGACGCCCGACCGAAGATTTGTCGGTCCCAGGGCGTGAGTGGCGAGAATTTAGGTTACCACGACGACGGCCGC
CTCTGACTACTCACGACGTGTGGGCACGCCGGATTGGAAACCTGGTGCCCACTGTAACGAGGTCTCGACGAGGGCAGCCGACGATGGTGCGACTAACGAA
CGTGTCACCGAAGATTGCTCACTGCGCGAGACACGAATCGGTACTGCTGTGGGTGAAAAAGGGTGACCTGCCGCAAGGGATGGATACACTCGTTTGAACT
CCGCTAAGTATGAGGAGTGGCAAGTCCTGGCGTACGCGGAGTGTCGAGACGAGACTTTGTTCGCGCGGGAACGCAAACTCTACGAACGATGGTTGGCAGA
TCAGCCACCAGCTGTAGAACGACGAGACTATCCGACACCTAGCGGCATCCTACCTCGACCATCCGACGACTTGGAAGGCCTAGACGAGGGCCAGATAACG
TTCGCGAATAGGGCACTGAGGAACCGACAGAACGAGACCGAACGCCGTTGACGACTTCGTGCAACCCTCTGACGAACCCGTTGGAGATAGATGGGTCGAC
GAAGATGACGACTCGGTGGCGACCGACACCTCTGATGGCGCGGATACCACGTATACGAGTGAAGAGAACTCCATCCCAGTCCTCGGTGATGACCCGGAGA
CCCGATTGGACTCTGCCTTCGTAGCAATGATGCATGAGATTACCGCGGGGGACGGTTCAGGTGGGAACACCGATACCAATACGTCCGAACATTTAGCGAA
TGAGATCGAGTTGACGGACTATGCACACGAGTTGGCGTTCTTACCGGACCTGACCGAAGCCTCGGAAACGGTACTGGATTATTCAGGACCGAATGTTCTG
AACCCGAGCGCGACAGCCCGTCAACAAGAAAGTCTCGTTGCGGTGCTGAAACGACACGAGAAGATCATGATTGCGAGTGGGAATGCTCTGCCACCACCGG
CCTACGGTGTGGTGTGCGATATTGACGTACAGGGGCATCCACCCATCAAACAGAGAGCTCGGAGAACACCGCTCCGACACCTTCGGAAGCTGTACGAGCT
TCTGAAAGGCTTGCTGAAAGCTCGTCTAGTGGCGTTTTCGGACAGCCCATGGGCGTCGCCCATCGTGATCGTGCTCAAGAAGAATGGAGTTGATATTCGG
TTGTGCATCGACTACAAGCTGGTGAATGCAGTGACGGCGATTATGGAGTACGCCATGCCGTTAGTCGACGACTTGTTGACCGACCTGGAAGCCTACCTAT
GGTTCTGCTCGCTTGATGCGGCCAGTGGATTCTGGGCTATTATGATGACGATGCGGGCCCGCAAAGTCTCGGCATTCGTCTGTGCACTCGGACATTTCGA
ATGGCTTCGTATGCCGTTTGGATTGAAGAATGCACCGATGATTTACCAACGAATGATTGACAATGCTCTGTGGGGTTTCGTCCAACCCAAAGGCGGCTGG
CTCCACTTTCGGAGCTTATGCGAACGGCCGAAGCCCACGCCGAGGTTGCGCGGACAGGGGTGACCGACCCTTCATGCGACGACTCGAGGAGTCAACAACT
CGGTGACCAAATTCGAGGCCGACCGCGAATCCTCGGTCACGCTTGACGCAGTGAATGGGTTAGTGAACAGCCCTGTTGCCGACATGTTCTCCACCGGAGA
ACCGGATGAATCCTCGTTGGTGCCAGTGTTCGACCGACGGTCGTTTGTCGATGACATCTGTTTTGGGTCCGAGACTTTCGACGCGTGCCTGGAGACGCTA
GACCGACTGCTCCAACGGTTCACCGAATGTCGCATTAGTGTGAGCTTTACGAAGAGTATCTTCGTCCAGCCAAAGGTGGATTTCCTGTCACACGAAGTCT
CTGCAGAAGGTATTCGAGCCGACACCAAGAAGATGAAAGCAGTGACCGAGCTGCCATTCCCTGCTTCAAAAAAGGGATGCAGTCTTTCCTCGGTGCGCTG
AATTATTACAGTCGATTCATCCAGGACTTCGCAGTGTATGGAGCAGCTTTGTACCAGTTGAAGGACGAAGACTTCACGCCTAGTGGCAGCCTCTCGGGCC
AAACGAAGCTTCGCGCGCTCCAACAGAAGGTTGCAGAGGCACCGATCCTCCGGCACTTTGACCGAGACAAGGAGGTGCATGTCACGTTATTCGCGAATGA
GTGGGCATTGAGCTCCACTTTGATGCAATACCATGATGACAAGCTGCACCCGGTTCGATTTTGTGGCCGAGTCCTCAAGGACGCCGAGATGAACTACCAC
CCGGCCGAGAAGGAGGTCTTAGCGCTACTGCTGGTGTTGAAAGTGTGCTACTCCCAGTTGGTGGGTCGGACCATCCACGTCTATACGCGTTTTTCGACGC
TCGAATGGGTGCACAAATCCAAGACACTGTTCGGTCGAGCGACCCACTTTGCGGTTATGTTGTCCCCGTGGCACCTGGTGGTCAACCGAGTCAAGGAACG
CGATTGCACGTTTGCTCAGCTTCTCCAAGCTGGCCTCACAAGCTTCGTGGATTGGAAGACTCGTTGGCCCCAGTTACACCGCCGACGAAAGGGTCACCTA
CTGCTCGTATGGACCCCACTTGCTTTATGCCTGCCTACCGAGGTCCTATACCGGATTTGTGATGTCGTTCGATGGTTCGGCCAAGACCGAAAAGAACGGT
GGATATGGCAGTTGCTCGTGGATTTTGTGGAAATTACCAGAATGGACTGTAGTGACGGCTGCGAGTGCTTATCTCGAGACCACCACGGTAAACCTCGCTG
AGTATGCTGGAATGAACAACGGCGTCTCAGCTGCGCTCGAACATGGAGCCGAGGATTTAGTCATCGTGGGAGACTCGAGACTCGCAATCCAGCAGTCCCT
AGGGGTGATGGCATGTCGAAAGGAGTCTCTGATGGTTCAACTGAATCGTCACCGAGAACTCACGACCAAGCTGCGGTCGGTGAAGTACTTGCACGTGGTC
CGAGAATTCAACGCTGCAGCAGATTCGTTGGCAAGCGAGGCTCTCAGCAGCAAAGAATCCAGCGTAGCTTCGACCGAGGCTAGGAAATTAGAATTGGTCG
AGCTGAACCGGATCGGAGAGGTCATCTATGAACCCTCAGTACAGACCACGGCCGAGAGAAACCGACAGTCAGCTTCGCCCGAGCCCAAGTAGCCCGTGGA
ATCTCCCGCGACAGATCTTTTTTCGACTTTGTGCGGGACGAACCCGACTACCTAACTGCAACAACCAGACACCAAGCAAAAGCGAGGAAGAAACGAGTCC
AGTTTGCAGATGAAACGTCGGTGATAGAGCCGAATGGTACAGCTGAGCGAGACGAAGCGAATGGTGTGACCACCGAAGCTCAGAGTGAGCTGAGAGCCGA
GCAATCGAGCAACGAGGGACCCTGGCGCTCCAAACGCAGAAGACGTTGACCCTGTGGTTATACAGGAAGAGCGCCGGAGACGAATCTCCGCCGCCCAGGA
TGAAGAGCTGAGATGGTCGAACCTAAAAGCGGTCCTCCGAGGCAAGGAAACAGACCTCAGCTACAGAGCAGCCAGAGACGCTTGGAAGATGGCCGACAAG
TTCGTGCTTAGCGAGGATGGTGTACTGTATTTTCTTGGAACGAAACCGTCGGTGGGGCAACGAACGCCGAGAGGAGACAACGATGCGTCTAGTGGTGCCC
ACAACGATGATTCAGGAAGTACTACGGAGTTGCCACGACTCGTTGGAAGGTGGCCACCAAGGTATCGGTCGAACGTACCACCGAGTCAAATCAGACTATT
TTTGGATTGGACTATATGCAGACGCCGAACGACACGTCAAGTCCTGCCCCGACTGTAGTTCGAGCAAAAGTCGACCACAGTTCCGAGGCTATTCGCCAGG
AAATGTCTTAGCAGAGCGACCGTTCCAGATGGTGTCGATGGATTTCGTCATACCGTTACCGAAGTCTCGTCGGCAACTCAGCCCTACTACTGTTCCAGTG
CGCGTTCACAGGATTCGTCATGGGTAAAGCTATGTCAGACACTACCGCTCTGAGGGTCGCACAGGCTTTCGAGGAATGCGTGTACCGAAGATTCGGAGCA
CCAACTCTGATCCGACATGACCGAGACCCTCGCTTCATGAGCGAGGTGTTCCAGGCCTTTGCAGAAATGATGCAGTCTCGGTCAAGAGCGACCCTGAGCT
ATCGGCCGCAGGCGAACGGACAGCAAGAGAGGTCGGTGAAGACGGTCATGCAATCGGTGCGGGTGTACGCAGAAGACCCGCTGCAGCAAGACTGGGACGA
GATCGCGGAGCGATTGATCTTCGCTATCAACAACTCTCAAGATGGCACCCGGAAGGACACTCCGTTTTACCTAGTTCATGGGTGGGACGCACAATCCACG
CTGCGAGCGATGTCGTCGTCACTCAAACGAGGATTCGGAGGCCAGACTGACGCATTGGCATGGCGCCGAGAAGTGAACCGGCAACAGGAAATCTCGTGGA
AAATGGCAATGGAGTACCAAAGTGTCGAGAAAGCTCGGAGGGCGAGAGAACACAATGAGTCGCTGGAGCGACGTGAGAGAGCTGCAGTACCGAATGTCGA
TGAAAACGAGACTTCTGACGAGTCACAGGTGGAGACGGGGGCAACATCTGACCCCACTGTCGAAGGACCGAGGTCTCTGTTCCAACCCGGAAGCAGAGTT
TGGTTGTATATGGAACGAGTCAAGCCAGGGTTGACCAAGAAACTCGCCCACCGATGGCATGGACCATTCAGGATCAAGAAAAAGATCGAAGAGTTTGCGT
ACGAGTTGGAATTGCCAGACCGAAGTGGGTATAGGTTCTACCCGGTGGTACACGTGTCCCGACTCAAGGCCGTCAACGAATTTGGAGACCGACCGAAGAG
TCGGTTAGCACCTGAAGTGACCGAGGATACGAGACTGGACTTCGACGAGGAGTTGTTGCCTGAAGATAGCTGGGAGCCAGACCAGCTCGCTGGCGAATAT
GAGGTAGAAGCCATCCTCGATGACCGATCCCCGCTGTCGACGAGCTGTCCGAGAGTTCAAAGTGAAGTGGATTGGGTATGATGAGCCCACGTGGGAGCCT
GCCTCAAATTTATCATGTGGGGGCTACTTTATGATTATCTGCGGACTCGGCGCAGCGAACGACGATTGCAGATGGTTCAAGTTGCTGACGAGAACTAATC
TGGAGAGCTACCGAGAGTTGAACTGTCTACGGGGGTGATACAGCCCGTAGCAACAGATGAAATTTGCTACTGTATCAAAATTGCGAGTGACCGACTATTG
ATTGCTACCAAGCCTCTGACGAGGCCTGGTTGCGACGTCGGTTGACGAATGAACTGCCTGCGGGGATGATGCAGCCCGCAGTGACAGACGAAAACTGCTA
CTGCATCGAATTTGCATATTTACATGTGACGTGAACGATTTTCGAATGGAATTGGATTAAATGGAATTACTTGGAGCTCAAGAACTGCCGCTACGGAGGA
CTACGGGCTTCGGACGGCACACTGGCAGCTTGAGGAACGAACGTGGAAAATGGATGAGGCCAGACCGAAGCCTAGACCTCAGGTGTCGACGCGATGTCGG
CCAAAACATCCAAATTCGACCCTTGAAGAGCGGCCAACTCGCTGTCTGCTGCCGAAGCGGGAGTGCGACTTCGAGAATGCTCGGAAGTGTCTTCACCTTT
CTCCTCCACGCTCGGCTGATCGGGGACACGAGCGACAGAAGCTTGGGCAGCCCATGGGGTCGTCACCAAAGCCGACGGAGGCGTGGGTGGGGACGAACCC
TCTGCACCCTCGCCCGCAGCCAGAGGAGTGGCAGCCGGCGACCGAGGAACGGTCACCGATGCTCCAGCGGAGCCAGAAGTAGCGGACGGAGTGCCGCTAG
CTTCCTGTGAACGTGGATAAAGATGGAGGCGGTCAAACAAGGTTCGAGGAGCATGAAGACGGAAAGAGAGACAGGAAACGAACCTCTTCGGAGGTGTCGA
GAGCAAAGGAGCGGCGGCCGTAGCTCGGCTCAGCAACGGCGAGCGGCGAGCCATCGGGGTGCGATCAAGAGGCGCCGCGACGCGCACTACTTGCGGGAGC
TTGCGTCGAGGCGGGGGCAGTTGTGGCGTTGGGTTTTGGAGCCGAACAGTCAAGGTCCGGCGGACGTTGCACCTTTCAGTGAACGGCGACAGAGTGTCTT
GATTGGCTGGTCTCATTTCCCGCGCTATAGTGACCTAGGAACAATAGTGACCGAGGTCTCGGCTGGGTCTAATAAAACCCCGGCCGAGGTTAAAAACCTC
GTTTGTACCCACTTCGGTGTCGTACCCTCGGCTGTGTAGAGCCGGCTATACGATTTCCCACAGAGATCTGTTTACACTTGATATTTGTATAGAGATATAG
GACTAGCCAAATGATGACCTACAGAGGCTCCCAGAGCTGTAGGATAAAGAGAAATAAATCAGCAGTCTTCCCCACAAGCCACCAAGGGTCAAGTCCGTCT
TCGGTAAGTCTAGCTAGCTTGTCTTAGGGTCTGGATACGCTCGGCTGCGTGGGATGCCTGTCAGCGAGCTTGAGGTACATTGAACCGAGAGTTTGTTGCT
GGTCAGTCCAAGAGATAGGAGTGGCCGAGAGTTAGGGGCGACAAGGAGTGTCGGTCCCTATATATTGGTGGAACCCGAGTGTTCCCAAGTGTATTTCACT
ACCCGCCGAGGTTACCCTCGGCAAACCCGTATTAGGCGTGACTGCCGGTACCCTACTTCTGAGGGACTGCGGGGGTTCGCGCGAAAGCGCAATATTGCAT
TCTAGCCCTCGCTCGTGGCTAGTAGTGCAGGTTTTAAGGTTGACCGAACTCAACCTTGGTATACAGAGGCGCTTACAACCAACCCGGTGTAAGGGATCGT
TCCTGGTCTTCAGGTGTTGATCCAACGTTCGCTGACCTTTCGCGAGGGAAGCGTGTGTTGTTGGTGGGACTCATACCGTTCGGTAGTGAGATTTTCTGCG
TGTTCCTACACGACAACTGGTGCCGCGACCCGGGATTGGTGTGATGCATTGCTCAGCTGTTGTTAGATAACTTCTTGGAGTAGTAGGGGCTTGTCTCGCT
GCAAGGAATGGTTGCAGTTGTTCTCGCTTAGTTTGTTTCAGTAGCCAAACCAATGATCGATCCATCGCTTCCAGGACAATTGCGCTTTGTCGCAGTCCCA
GCTTATATATGATCAATCGTATCTAATGTGGTGCGTGCAGGTCCGACCGTGAGGCCATCCATCATGGAAAACGGATAAACGCGCCTAATGGGGGGGGGGG
GGTTAAGAGGTCTCAAGTTGTGTTTAGCTAAGAAATTATTGAGTCCTAGTATCGCTGGAGGCTTGCCTATTGATGACCTTTCTGTGGCTTATTGTCGCTG
CTAGTTTTCAACAGGTCGTCTTGGATGCGGATCCGAAGTGTTGCACTGTCGTGGCGGAGCATCTCTTTCGTATATTTTGCCAATTGGTACGACTTGAGTA
ATGTTGCAACCGCTTTTTGTAGTGTCTTGTGTATTGTTTTCCAAACAGTTGATGCAGTATCCGCCACAATTGCTCGATGCTCTGGTTCGCTCTTGCAGGC
TTTATGTCTACTTGTGACCCTTGTACAATAAGCCTTACCGTATACAGGATAGTCTCTTGCTTTAGCTGCCGGGTTGCCCTTAATATCATCCATGTTGTCA
CTATAACTCCTGGTAATTCTTGCTCACTTTGAAAGAAGCCCGCCCACTCCACCCGTGGTGGATTTGTCCCAATAAACCCAAACGCCTCGCTTTCCCAGTG
CATCTTCTCGTTTCACGGAGTGGAATGGACATGCCACTCATGCAATGTATCGGCCGACTCACAGGTGGCATCGCCATGAACACAACATAACATTGAGCGA
CGCGAAAACCTATTGCTTGGGTCGGGGTATGAAATGTCATTCCCCGGATTACGCCTTGAGCCTCGAAATCAGCCGATTTCCACAGCAGCCGCTTTGCTTC
CTGTGTTGTAATTTGCTTGCTGTCAAATATCTCCCGGTTACGAATTAGCCATAGCGTGCATTGAGTGCACGTTGTCCATATGAGCCAGATAACTTGCATT
GCCGCTTCACTCTCTTCTCCCCAGTCTGGTATGCTCTGCATTGCTTCTGCGAAGAAGTTTGGAGAAGTAGGCGGTGCTTTTCGAGCTGCAAGATGTGGGA
GTAGAGCAGATAGTTCGGCCCTGTGAAGGTAATGTCCTACCCATTGGGGGAGCCATTATTGCCACACCATCCTGTGCTCGAGTGCAGTCCCATAGTATAT
GTTCGATAGTTTCAGGAGTGGCTGAACATTTTTGATGTGAACATTTTCGATTTGACGGCCAGCCTGAATGATACAAGTTCAATGATTGTGTACATACCCG
GTAAATCGTCCACCTTTGAAAGTCTGTTAGGATCCCGTCTTGGTGCCATATTTGCTTAGGCTGCTGTGATTGCACTGCTCGTGCCCATACATGCGTCTCG
GCTCCAGTTGTCATTTTGTCAAGTACTCGTTGAATTGAAAATTTAGGCTGTCGTCTCGGGCGTTTGGATCGTTCTGCGGAGCCCGTCCGCCTTCGTTGAT
GCTGGTGCCACCCAAGGTGTGGTTGCAGATGAGGTGTGGTCTCAATGCTAGTCCTGATACTCGTTGTTTAAAATTCTAGCGCTTGTACATCCTTGTCAAA
ACTATCATCCAGATCCCGATAGACGATCGACCAAGTCTGTAGCGGGGCTACACATTCGGTTCACCTCCTACCTTAGTGCAACATGCACTAAGGCATACAT
TCAGGTGACCACCACAGGGTGGTCCACATTCATAGCAAAAGGCATATGACTGGTAGAAAGTAACACCTTTCTACCAATGAGAGTCATTCAATAGATAGGG
GTTCTGCCAGCCATCCAATGGCAGAACCTCTCATTAGAAATATCAGTTTTAGGAGGAAACCCCATTTACAATCAATACAGTTCTCATTTACCACCAAAGC
TTCGTTTTCATTTATCTAGGTTTAAGTATACTTGTGGATACAAGTATACTGAACTTAAGTAAATTACTCCTACGCTTCCTCCTACACGTGCGCACACGTG
TAAGCTTAAGTAGTGGGTCTAAGCAGACCCATTACACCTGGTAGCACTTTGTAGTCCGTCCAACGACCGACTAACACGTTCGTATGGAATACGAACGCGG
GGCTGAGAACCTGCCCTCGGACAGTAACATGTCCGTGGGTAGCCCAAACTCTGCAACGCATGTTGCGCGTGCAGACTGCCCCCACCTGTCGGAACCAGAG
TGGGAGGCCCTCCAACGACTGTCAACAGTCATTGGGGAAGCGGCGGTAGCAACGATGTTGCGAACGCTATCACCGACGGAGCAACACGGTGTTGCTCTGG
GTTTCATCGTGAAGGAACAGCGTGAAACCGCTGCTCGAACTTCGGTGTCGCCATCGGCCACACCGCGCGTGGAGTCATTGAAACTCCACGTAAGCAGCTA
CGTTGGAAGAGAGGGCGAACCTCTCCTCCGTTGGCTTGTCGAGGTCGACACTGCCATTACGGCTCGACGTATCGTCGACCCGTTGTCGAAGGTTGCGTTC
GCCATGTCATGTCTTGGCGGACGAGCGAGGAGTTGGGCGTACGGACGCCGACTCACAGATCCTACGTGCTTTAGCACGTACGAGGTTCAAGGAGGAGCTC
AAACTAGCGTTTGAGCCCCCGCAAACGAGTTCCGATCGAGGGCGGAGTTCCTCGATCTGCAACAGGGCAAGCATGACGTGCATGCTTACGCCCAAAGAGC
ACGGTACTTGGTCTCGAACATCGTGACCAACCCGATTGACGAGGCGACAAAGGTCGTCACGTTCATGAAGGGCCTTAGAGATGGGCCTGTGAAGACCTAT
CTCTTCCGAGAGTATCCAAATACTCTCGAGGCTGCAATTGCGCTTGCAATGCAAGAAGAGTTTAGCCTGCGGCAGGCTAAACTGCATGTGAACGCCCCAC
GGCTGATGCCACGACCGGTGGCAAGGCCGTCGGGAGGTCCCGAACCAATGGACCTCTCGAGTGCGACCGCTGCTGGTTCCCAGCAGCGTCGTGGATCAAC
GAATGTGCGTTGTTTCCGCTGCGGAAACATCGGTCACTACGCCCGCGAGTGCACAGCACCTGTGCACGCGGCGAGGAGCCGTCGTGGCGATACTGGGTAT
CGTCACGGGCAATCAAAAAACTAAAGGGACCAGCAGGCGCGGGGCGCCCTGCTGGTGATGCGATCGAGCGTGTCGACATCGGACACGCTGCAATGAAGAT
CGCTGCCCCCAGTGAGAGTCAATCTCACTGCAAGAAGCAAGATGACAAGCCGAACCTTGTCATCCTGAAGGTAAGCTCGAAGAGAGAGAAGTCTCTTCGT
GCTCTAGTGGACTGTGGAGCGTCGAACAACTTTGTTCGACTGCAGAGCCTTCCAAGGCTTGACTTCGAGGAGGTGAAACACCTCGAAGTCTATTGGAAGT
GAGGCTAGCAACGGGTGTCGTTGTTAGAACCGAGAAGCGTATCGTACGCGTACGCTTCTCTTATCAAGAGAAGGAGTTCGTCGACGAGCTTATCGTCCTG
GAACTGGACGATAAGTTCGATATGGTGTTGGGCATGCCGTGGCTTGCACGGCATGATCCGGTGATCGACTGGACGAAGCGCACGATCGTGCGCTTCGGGA
GCAGCAGCAGCGCGACAGAGAGCGATGGCCCTGTCGGCGCAGCACATGCACCACGTGGTGCATGCGGCCCTCCATCAGAGACAGCGCGGAATGCGGCTGT
CTCCGTCACCCCAAGCGAACGCCAACGACTGCGAGAGTCGTTGGAAGAAATGTGAACGAATCAGCAGGGCCTGATTCAATCGGATTCGAGAGGGTCTCGA
AGCGTCCGGGCGACGCGGTCGTGTCGACAGATAATGTCGACACCAAGCACCCCACGAGCAAATGACGAGCACGACTCGTGAGGTTTTTTCCGCGAGCAAT
AAAACCGTACGAGCAGTGCTCGCGAGGTTTTTCAATTCGACCTCACTGATCACTTTTTTTTTCTTTTTTTCTTTTTTTTGGGGGGGGGGGGGGGGGGGGG
GGCACGAGAATATCAGGTGCATTTGCTCGTTCTCCGACGCTTCAATTGGGTGTAAAAGACCATTTTTTAATTGGCCGTTATTCAGCGACGATCTTCTGCA
GGCGTAAGTAAAATAGAATCCCGCTTTCCAGCAAGTCCGTCCGCCCCAGCAAGTCCCCGCTCCCGACGTCATGGTACTGACCCGGGCCAGGCGAAAGCAG
AAGCGGAAGCTCAAGCTGCGCGAGGCGACGAAGACGATCATGTTGAAGACATATACGACCGCCCAAGCGCCGACGTCGAGTACCCTGATGACGAGACCGA
ATACATGACCGAAGGGCCAAGTCGCGACACCGCGTCGGCGTTAGTGGTGGCAGAGAAACCAGGGGCGAAAACTTTCCCTGGTATTGAAGAACACCTCGAG
AAACTGGCGGGGTTCTTTCTCGCCCAAACGCGATATCTTGTGGAGGGGCACGCGATGCTGCAGTCCCAGCAAGAAGGGCAGAGTAATGCCCAGAGCGCCG
CTCTAATGGCCGATCAGGGCTCGACCGAAACCTGCATCAAGCAGCTAATGGATCAGCAGCTTGCAATAGCTGGTCAGTTCCAGGAAGAGCTGATGGCGAC
TCAATCGGCCATCTATGAACAGCTTATGGCGATGCAAGCGCAAGCTGGAGAGCAGATCAAAAAGTCTGTGACGGAGAAGCTCTTCGATGCGCTGCGTGAA
ATGCAGTGTGAGTCCCATGCGCTAATATTCTCCCTAGCGAATAGAGTCAATCTACTGGAGACTCAGCTGGCCGCCAAAATGAACGACATCTTCCAGATAC
TTACATCTCGGATCCAGCAGCTCGTCGAGGAGCAGACGGCGGTACGGCAGCACGCGAGCACCGCTTCCGAGAAATCTGTCGAGCTTGTTTTTGAGCGTTT
GGAGAAGTCCATGACAGGCATAAACGCCCACGTGGAGCAATCGCTAGAAAGAGGTTTACAAGTCGCGCGCGATGAACTAAGGCAAGAAGTATGTGCAAGC
GCGGTGATCTCGACTGGAGAGTCAGTACTCGACGCGGTTAAGCATTTAGTGGCGGCTGAGGCGATAAAATCAGAACGACGTATCGAGGCACATGTGCAGA
GAGGACTGACGTCCTTCCAGACTGATATACAACTTCAAGTTCAACGCCAAGCGGACGCAACTTCCATTCTGCGGGATCAGTTCCAGCAACACTGCGATCG
TGCTCAATTAAAGCAAGGGTCAGTAGGTGAGGGACTTCGCAGTAACGACGCAAAGGAACTTGTGCGAAAGGAGGTGGACGAGTGCATGACTACTTTGCAG
CACCAATTCCAGGCCGTGGAACTCCAGGCCGTGGAACGCGAGCGACAAGCTGAATTACAAGCGAATGAAACGGAATTGCGTCAATTGCAGGCCGTGGAGC
ACGCACGTGAAGCCGAATTGCAAGCGAAAGAGACTGAAGTAAATCATGGTGTGACAGAGGTGGTTGGAGAGCGTCTGCGAGACCCTGCAGCCGATATCTC
GGCAGAGATCAAGCAATCACTGGAGCGAAGCGTGAAGATGATAATTGAACTCATTAGTGCTGCTGTCGCTCGCAACGCGCAGACAAAGGAGGAGATCAAG
ACATAGATTGAAAATCGTAGCAGCGTTAGTGAAGATGATGGAGATGAATATTACGATGAATTGTCGGAAGAAGATCACTACGAACAGCAGCAAATGCGGG
ACGCCCTCATTAGGGCTCAAGCTGCAAGCACATCACCGATGCCTTCACTCCGCCCTCATTAGGGCTCAAGTCGCAAGCACACCACCGATATTTTCACTCG
TTGTGCATGTGGAAGGACCACTGCTTCAAGATGGCGAGCGTTTTAGGAACAAATACAATCACCATGGATTTCCACCAGCAGTGCAAGGTCGTGCTACACC
ATCTCACAGTGTTTGTGGCGGTCGCAGAGGTGGTGGTCACAGTGGGAGAGACTGCTGATGTCCTGAAGACCGCTGGAGAACCTCACCGTGGAAATGATAC
TGAGTCTGCGGAGGTGGCGAGCTGAGGTGGAGGTCGTTGTCAGACCGTCGTCGAAGAAAACGTCCCTGAACTCAAGCAGGAAGGCTGTAATCGCGGTGCC
AGCGGTGATAAACTCACCGTGAGAAATATACCATAGTTGCCGAGGTGGTTGTGTCATGCGAGACGAATACGAGGATAAGACGAAATAAACGTAAAGCATA
TGATCAAACAAAAAAAACATATATTAAACACAGTGAACGTGAAACTACGAGTTCTCATTCTACTCCTCGTTCAAGCTGAAACTCGTGCTCGACATGAAGC
CAGCCAAGATAATCATCAGCGAAATCATCCTCCATGTCCCAATCCAGATCCAGAGGGTAAATGAAGCAGGAGGGCGTGTGCTCGCGGTGTTTCCCCCTTT
TGATCGTCTCACACTGCAGTAGATCCACAAATTCGTCGTTGCGGTTCATGAACGTGGCCATGTCGATGTTGTGTTGCGACAAATTGGTACGTTGTGACGT
AACCATACTTCCGCTAACGCTGAAGTCCCGCTCAATCTGGCATGATGATGCTGGGATGGCAAAGAGCAATTTCACTGCGCGCGGTAGAAAGATGTAGTAT
TTGCGGTGCTCAACTCGCCGCCAGAATGACAGAACCGATTCAGGTGCACCTGACTCCGACCGTTCCACCTCAATTGGGTCGTATTTCCAGCGATTTAGCT
CTTCGTCCACGCATCGCTGCATTTGGTTCATAGTGGCGGCCGCTGATCTGCGCGGGGGGGGCAAACATCGCCTCGAGCTCACTATAAAACGGGGTGGGAC
TCGGAGGAGGTGGCTCGACTGCATCACTTGGATCCACTACATCGTTCAGCAAGGTGTGTAGCCGATCGCAAATATGCTGATGCACTTTGTCCCTCTTATT
GCAGGCCTCACGTATTCCAAACCCTTGCTGTTTGCAGACCAGCAGGATGACGGCATTTA
	
	
TGTCGCTCCCAGTCACAAGCTGGAAGCGTTTCGCTCGCGAACTGCACGATGGACGCATCGAGCAGATCTGCATCCTCTCGGACGTCGAGAGGATGACGTG
TGAAGCAGAAGAGCTGAATCAGCTCATCTCTGAGGGCGCGGACGCCCTCAGCGCGAAGTCGAAGAAGGAACGCTTCGACGAGCAAGGCTGGGACTCGCTC
AAGGCGAGCCCCTTTTACAAGGTCTTGCGTGAGTACAAGGATGTACTCCCGGACGACATTCCTGCGGAGTTACCGCAGGACAAGGGTGTTCAGCACGAGA
TTGATCTCGTGCCGGGAACGAAGTACTGCGTCACGCGACAGTGGCCACTGCCGCGTGAGCAAGTCAAGGCAATCGACGACTTCTTTGAAAGTCGTCGCAA
TGCAGGACAAGTGCGGGAATCGAAGTCCCCGCACAGCGCGCCTACGTTCTGTGTGAAGAAACCACAGGGCGGGTGGCGCATCGTTCATGCGTACAACAAG
CTGAACGATGCGACGGTACCGGCACAGACGCCGATACCTCGAAAAGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGTACTCTGGATCTGA
GAGACGGGTTCTATCAGATCCTCATGCGTGAGAGTGATATCCCTCTCACGGCGGTAAGCACTCCGAGCGGCATGCTCTGGGAGTGGCTCGTGATGCCGCA
GGGGCTGAAGAACGCCCCAGCGACGTTCAACAGGTGCGTCACGCACTTGTTGCGCTCGGTGCGCGACTTCGCACCGAGCTATTTCGACGACGTGTTCATT
CACAGCCGGGCTGTGAATGGGAAATCGGATGTGGAGATGCATACAGAGCATCTCCGCAAGTTGCTTGAGCTCATGCGAAAGCACAAGCTCTACGCGAACC
TGAAGAAGTGTATCTTCGGGGCGACCGAGATACCCGTACTTGGGTGTCTCGTGGGGAAGAACGGCGAACTGCGGCAGTTCCTTGGACTCGCCACGTACTT
GTGCAAGTACGTGAGCAACTACGCGGGCAAGATTCGCCCGCTGTCGCAGCTCTTAAAGAAAGAGGCTGCATGGGAATGGACTGCTGATTTCGACGACAAC
GCAGATCGCATTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTACGAGTACCACGATGCCCCGACATCGGGACATCCTGGCCGTGAGAAGA
CATATTTGCTTCTCACGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAACTTTCAGGCGCTGAATCGCAAGCGATCGTTCCTGCGTCAGCC
CGAGGGTGACAACAGCACTGAGAACGCCCCGGACGCGAGCGCAAACGCTGGTGGCGGTGGCGTTAGCCCCATCCCGATGGGCGAGGGTGTCGTGTTGCCT
TCCTTCTCGCGACCACGCCACGTGCGGATGGAAGACGTCGACGCGCTATTTTACAAGGGCATGATGTCCCTGGACGATGGCGAGCAGCAGCCGCTCAAGA
CCAACGTCCAGCAGCTTCAGGACACCCGCGTCTCTCGGCCACGACAGCTGCGACTCCAGCGACAGCGCGTGGTCACGTTTCTGGCCTTCGTGGGCTTTGG
CCTCGCGTCATGGATCATGACAAACGTAACGTACGTGGAGCTGGGCGTGTTCCTGCGCGAGTTACCGGAGCACTACAGTATCTACGCCTACTCGATCCTC
GCACTCGAGTCGGCCAACATCTACCCGATGCTCTACATGATTTTCAATGCTCGGCAGCAATTGCTGAGCCAGTCCACCGTTATTTGGTGGATTTTGGTGC
AAGGCGTGGTGGTAGCGGTGCTCATGAGTCTCTTGTGGGACCAAACGGCCAATGTATTTGGATCGAGACACAGTGTCGCGATGCTGGTCCTGACACATTT
CGGGGGCATGGTGAGCACGACGTCCAGTGTGGTGTTCTACCCGTTCGTGGCGAACTTCCCGCCGCTCTTTACGAGCGCGTTGTCCACGGGGGAGGGGCTC
AGTGGGTCTTTAGCGGCGTTGCTGGGCATTGTGCAAGACCCTGGGGGTGTCTTGCGCTACTCCGTGTCGACATTCTACCTTATTTGTGCTACGATTATGA
GCGTGTCGCTCGCTGCGTTTGCGTATTTGCAGTACCATCCGTGGGCACAAGCGGTGCAGGCTTCAGAAGAGATGGAGGCTGCGACAAATGGGTCGGTACA
GGACCAGAAGCAACGCGCCTTGGAACTGGATGAACGGGCTGCGCAAGAAGCAGAGGAGGACACGCTGCTCAGTCGGAGCTCCTGCGTCGACAAGTCTGAC
GAGCAGGTCATCAAGGCGCTGAAGATGGACGGGCTGACGGGTACTGCGTTGAAGGCCCACCCGAATTACAAGCAACTGGAGAAGTTCATGTACAAGCGCG
AAGGTCAGCAGATGGACAATTGGCTTGCGGAAGGAATGTCAACGAAAGACGTGTGGAACGATTTGGGGCTGGCAGGAATGAGCAAGGCGCAACGCAAGAA
TAGCGACGAGCTCAGAGCGTATCCCAGCGAGATGAAGGTGAAAGTACAGATTTGGGCCAAGGCGAATCGAGAGAAATGGTACGTGAAGGAAATGCTGGGG
CTAGATGGTATGTCCACAGTTAAGCGAGAAGCGAACCCGAACAACAAGTACTACCTGGAATTCTTGGATTTGACGAAGCGATCAGAAAGGACGCAGCGAG
GGGTGAGGTCGCTTGCGCGAAACCTCACCGAAGAGTTGAACGAAGTGGCTGGTCCCGAACCAGCCAACGGTTACGACGAAGATGAGTCCGACGATCACCG
ATCGTCGGCGATGGCCGAGGATGCGAATTCTCGGCCGAATGGCGGCCGGCCTCCTCTTAACGGAGACACCCCGGCCGCCAACCGAGTTCTGGGTCGATAC
CTAGAACTCATGAAGGTGAAGAGCAACTGGATGCGATCCTTCGCTCCAGAGGTTGTTCGCCAAGCCATCTGGATGGAGCTCGGTGGCGAGTTAACTGTGC
CCGTGGAGTCGTGGAATACTCGGCAGGTGGCCGAGGACACGGTGCAACTCCTACGCGCTATGGGATGTGAACCCCAAGTGTTCCCGTCGGAAGCAGACCT
CCGAGCATGGGCACCCGAGGACGCCGCTACGGCGCTTCGCAAGTGGAAGCAGAAGCTTCGGTCGGCCTTCGGGGTGGCCGAGGCGGGAGTTAGCCATTCG
TTCGACGTCGGAGACACCGGGGGTGACTTGACGGGAGAATGGGCACGCCAAATTCGTGAGCTGAGCGCTGTGGAGAATGACAGTGCGACACCGAGGCTAG
AGATCGCTACGCATCTCCCACTCGGAAACATCAAGCCGTACTTGGGACTCCGCGATAAGAGCGAGAAGTCCATGCAGTGGCTCCGAGCGTTCATATACGA
GATGAAAGGGACGCACACGCCGCCCAACGAATGGTTCAACCAGTCTGCGAAGGCTCGGTACTACTCGGCCAAGCGAGAGGAGAAGGAGCATGTCTGCGAC
TACCTCAACCGACTTAACGGCTATGCTCGCAACGCCGGAGTGCAGTTCGAGCATGGCGGTCGTGATGCAAAGGACCACGTCGAGCATTTCTTGGATTCGT
GCGAAGACCGAGGATACCCGGAAGCGTACAACGACGGATATGATGACACCGAGGAGTATGGGCCGGAGTCTCACTCTGGCGATGACGACCGATACTCCGA
AGGGTACTCGGACGACGGATACGCGTCGACCGAGGACCGAGGCCACGTGGCTGCTGCAAACGACTCTGAACGTCGCAATGCGGCTGAAGGAACGTTCGCT
CGCGCCGACAACCGAGTGGACGTGGTCCTGGGAACAGACTTCATGATTCCAGCCGGAGTCCGGTTGGATCTGTTCCACGGTACTGCGAGACTACCGGACG
AGGTAATGGTGCCCCTGGTGAAGTCGCAGAACCCAGCAGAGGCCGAGCCGTACAGCATGCAAGTGACTGGACGCCCGACCGAAGATTTGTCGGTCCCAGG
GCATAGATGGGTCGACGAAGATGACGACTCGGTGGCGACCGACACCTCTGATGGCGCGGATACCACGTATACGAGTGAAGAGAACTCCATCCCAGTCCTC
GGTGATGACCCGGAGACCCGATTGGACTCTGCCTTCGTAGCAATGATGCATGAGATTACCGCGGGGGACGGTTCAGGTGGGAACACCGATACCAATACGT
CCGAACATTTAGCGAATGAGATCGAGTTGACGGACTATGCACACGAGTTGGCGTTCTTACCGGACCTGACCGAAGCCTCGGAAACGGTACTGGATTATTC
AGGACCGAATGTTCTGAACCCGAGCGCGACAGCCCGTCAACAAGAAAGTCTCGTTGCGGTGCTGAAACGACACGAGAAGATCATGATTGCGAGTGGGAAT
GCTCTGCCACCACCGGCCTACGGTGTGCTGTACGAGCTTCTGAAAGGCTTGCTGAAAGCTCGTCTAGTGGCGTTTTCGGACAGCCCATGGGCGTCGCCCA
TCGTGATCGTGCTCAAGAAGAATGGAGTTGATATTCGGTTGTGCATCGACTACAAGCTGGTGAATGCAGTGACGGCGATTATGGAGTACGCCATGCCGTT
AGTCGACGACTTGTTGACCGACCTGGAAGCCTACCTATGTCGATTCATCCAGGACTTCGCAGTGTATGGAGCAGCTTTGTACCAGTTGAAGGACGAAGAC
TTCACGCCTAGTGGCAGCCTCTCGGGCCAAACGAAGCTTCGCGCGCTCCAACAGAAGGTTGCAGAGGCACCGATCCTCCGGCACTTTGACCGAGACAAGG
AGGTGCATGTCACGTTATTCGCGAATGAGTGGGCATTGAGCTCCACTTTGATGCAATACCATGATGACAAGCTGCACCCGGTTCGATTTTGTGGCCGAGT
CCTCAAGGACGCCGAGATGAACTACCACCCGGCCGAGAAGGAGGTCTTAGCGCTACTGCTGGTGTTGAAAGTGTGCTACTCCCAGTTGGTGGGTCGGACC
ATCCACGTGTTCCAGGCCTTTGCAGAAATGATGCAGTCTCGGTCAAGAGCGACCCTGAGCTATCGGCCGCAGGCGAACGGACAGCAAGAGAGGTCGGTGA
AGACGGTCATGCAATCGGTGCGGGTGTACGCAGAAGACCCGCTGCAGCAAGACTGGGACGAGATCGCGGAGCGATTGATCTTCGCTATCAACAACTCTCA
AGATGGCACCCGGAAGGACACTCCGTTTTACCTAAAGGAGTTCGTCGACGAGCTTATCGTCCTGGAACTGGACGATAAGTTCGATATGGTGTTGGGCATG
CCGTGGCTTGCACGGCATGATCCGGTGATCGACTGGACGAAGCGCACGATCGTGCGCTTCGGGAGCAGCAGCAGCGCGACAGAGAGCGATGGCCCTGTCG
GCGCAGCACATGCACCACGTGAAGCGGAAGCTCAAGCTGCGCGAGGCGACGAAGACGATCATGTTGAAGACATATACGACCGCCCAAGCGCCGACGTCGA
GTACCCTGATGACGAGACCGAATACATGACCGAAGGGCCAAGTCGCGACACCGCGTCGGCGTTAGTGGTGGCAGAGAAACCAGGGGCGAAAACTTTCCCT
GGTATTGAAGAACACCTCGAGAAACTGGCGGGGTTCTTTCTCGCCCAAACGCGATATCTTGTGGAGGGGCACGCGATGCTGCAGTCCCAGCAAGAAGGGC
AGAGTAATGCCCAGAGCGCCGCTCTAATGGCCGATCAGGGCTCGACCGAAACCTGCATCAAGCAGCTAATGGATCAGCAGCTTGCAATAGCTGGTCAGTT
CCAGGAAGAGCTGATGGCGACTCAATCGGCCATCTATGAACAGCTTATGGCGATGCAAGCGCAAGCTGGAGAGCAGATCAAAAAGTCTGTGACGGAGAAG
CTCTTCGATGCGCTGCGTGAAATGCAGTGCCTCACGTATTCCAAACCCTTGCTGTTTGCAGACCAGCAGGATGACGGCATTTAG
	
	
CRSQSQAGSVSLANCTMDASSRSASSRTSRG_RVKQKS_ISSSLRARTPSARSRRRNASTSKAGTRSRRAPFTRSCVSTRMYSRTTFLRSYRRTRVFSTR
LISCRERSTASRDSGHCRVSKSRQSTTSLKVVAMQDKCGNRSPRTARLRSV_RNHRAGGASFMRTTS_TMRRYRHRRRYLEKM_SSIR_PRVLSSVLWI_
ETGSIRSSCVRVISLSRR_ALRAACSGSGS_CRRG_RTPQRRSTGASRTCCARCATSHRAISTTCSFTAGL_MGNRMWRCIQSISASCLSSCESTSSTRT
_RSVSSGRPRYPYLGVSWGRTANCGSSLDSPRTCAST_ATTRARFARCRSS_RKRLHGNGLLISTTTQIALSCRMIMS_SSRSRTSTTMPRHRDILAVRR
HICFSRVTSIGVTSTSGYATFRR_IASDRSCVSPRVTTALRTPRTRAQTLVAVALAPSRWARVSCCLPSRDHATCGWKTSTRYFTRA_CPWTMASSSRSR
PTSSSFRTPASLGHDSCDSSDSAWSRFWPSWALASRHGS_QT_RTWSWACSCASYRSTTVSTPTRSSHSSRPTSTRCST_FSMLGSNC_ASPPLFGGFWC
KAWW_RCS_VSCGTKRPMYLDRDTVSRCWS_HISGAW_ARRPVWCSTRSWRTSRRSLRARCPRGRGSVGL_RRCWALCKTLGVSCATPCRHSTLFVLRL_
ACRSLRLRICSTIRGHKRCRLQKRWRLRQMGRYRTRSNAPWNWMNGLRKKQRRTRCSVGAPASTSLTSRSSRR_RWTG_RVLR_RPTRITSNWRSSCTSA
KVSRWTIGLRKECQRKTCGTIWGWQE_ARRNARIATSSERIPAR_R_KYRFGPRRIERNGT_RKCWG_MVCPQLSEKRTRTTSTTWNSWI_RSDQKGRSE
G_GRLRETSPKS_TKWLVPNQPTVTTKMSPTITDRRRWPRMRILGRMAAGLLLTETPRPPTEFWVDT_NS_R_RATGCDPSLQRLFAKPSGWSSVAS_LC
PWSRGILGRWPRTRCNSYALWDVNPKCSRRKQTSEHGHPRTPLRRFASGSRSFGRPSGWPRRELAIRSTSETPGVT_RENGHAKFVS_ALWRMTVRHRG_
RSLRISHSETSSRTWDSAIRARSPCSGSERSYTR_KGRTRRPTNGSTSLRRLGTTRPSERRRSMSATTSTDLTAMLATPECSSSMAVVMQRTTSSISWIR
AKTEDTRKRTTTDMMTPRSMGRSLTLAMTTDTPKGTRTTDTRRPRTEATWLLQTTLNVAMRLKERSLAPTTEWTWSWEQTS_FQPESGWICSTVLRDYRT
R_WCPW_SRRTQQRPSRTACK_LDARPKICRSQGIDGSTKMTTRWRPTPLMARIPRIRVKRTPSQSSVMTRRPDWTLPS_Q_CMRLPRGTVQVGTPIPIR
PNI_RMRSS_RTMHTSWRSYRT_PKPRKRYWIIQDRMF_TRARQPVNKKVSLRC_NDTRRS_LRVGMLCHHRPTVCCTSF_KAC_KLV_WRFRTAHGRRP
S_SCSRRMELIFGCASTTSW_MQ_RRLWSTPCR_STTC_PTWKPTYVDSSRTSQCMEQLCTS_RTKTSRLVAASRAKRSFARSNRRLQRHRSSGTLTETR
RCMSRYSRMSGH_APL_CNTMMTSCTRFDFVAESSRTPR_TTTRPRRRS_RYCWC_KCATPSWWVGPSTCSRPLQK_CSLGQERP_AIGRRRTDSKRGR_
RRSCNRCGCTQKTRCSKTGTRSRSD_SSLSTTLKMAPGRTLRFT_RSSSTSLSSWNWTISSIWCWACRGLHGMIR_STGRSARSCASGAAAARQRAMALS
AQHMHHVKRKLKLREATKTIMLKTYTTAQAPTSSTLMTRPNT_PKGQVATPRRR_WWQRNQGRKLSLVLKNTSRNWRGSFSPKRDILWRGTRCCSPSKKG
RVMPRAPL_WPIRARPKPASSS_WISSLQ_LVSSRKS_WRLNRPSMNSLWRCKRKLESRSKSL_RRSSSMRCVKCSASRIPNPCCLQTSRMTAF