Scaffold : contig_71
Gene_id : Phyra_g9653
Description : hypothetical protein
TGTCGCTCCCAGTCACAAGCTGGAAGCGTTTCGCTCGCGAACTGCACGATGGACGCATCGAGCAGATCTGCATCCTCTCGGACGTCGAGAGGATGACGTG
TGAAGCAGAAGAGCTGAATCAGCTCATCTCTGAGGGCGCGGACGCCCTCAGCGCGAAGTCGAAGAAGGAACGCTTCGACGAGCAAGGCTGGGACTCGCTC
AAGGCGAGCCCCTTTTACAAGGTCTTGCGTGAGTACAAGGATGTACTCCCGGACGACATTCCTGCGGAGTTACCGCAGGACAAGGGTGTTCAGCACGAGA
TTGATCTCGTGCCGGGAACGAAGTACTGCGTCACGCGACAGTGGCCACTGCCGCGTGAGCAAGTCAAGGCAATCGACGACTTCTTTGAAAGTCGTCGCAA
TGCAGGACAAGTGCGGGAATCGAAGTCCCCGCACAGCGCGCCTACGTTCTGTGTGAAGAAACCACAGGGCGGGTGGCGCATCGTTCATGCGTACAACAAG
CTGAACGATGCGACGGTACCGGCGCAGACGCCGATACCTCGAAAAGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGTACTCTGGATCTGA
GAGACGGGTTCTATCAGATCCTCATGCGTGAGAGTGATATCCCTCTCACGCGGTAAGCACTCCGAGCGGCATGCTCTGGGAGTGGCTCGTGATGCCGCAG
GGGCTGAAGAACGCCCCAGCGACGTTCAACAGGTGCGTCACGCACTTGTTGCGCTCGGTGCGCGACTTCGCACCGAGCTATTTCGACGACGTGTTCATTC
ACAGCCGGGCTGTGAATGGGAAATCGGATGTGGAGATGCATACAGAGCATCTCCGCAAGTTGCTTGAGCTCATGCGAAAGCACAAGCTCTACGCGAACCT
GAAGAAGTGTATCTTCGGGGCGACCGAGATACCCGTACTTGGGTGTCTCGTGGGGAAGAACGGCGTACGCCCTGACCCAGGAAAGGTCAGAGTGATCAAT
GAATGGCCTACGCCTTCAAACGTAAAGGAACTGCGGCAGTTCCTTGGACTCGCCACGTACTTGTGCAAGTACGTGAGCAACTACGCGGGCAAGATTCGCC
CGCTGTCGCAGCTCTTAAAGAAAGAGGCTGCATGGGAATGGACTGCTGATTGTCAGCAGGCCTTCGAAGCAGTCAAGCAGGGCTTGACTGAGGCGCCGAT
CTTGGCGGTGGCCGACCAAGATCGCCCATTCCACGTTGTGTGCGATGCATCCGATTTCGCGATCGGATGCGCACTGATGCAACTCGATCACGAAGGTCGT
GATCGTGTGGTTTACTACCAATCGCGTCAGCTGAAGCCAGCTGAGCGCAATTACCCGGTACATGACAAGGAACTCCTTGCCATGAAGTATGCACTCGCAA
AGTTTCGAGTGTATCTACTTGGGAGTAGACCATTCGTGGTCTACACCGACCACGCATCGTTGCGTACGGCGATCAAGTCGCCGCACATATCACAAAGAAT
GGCACGGTGGCTGTCATTCTTTGCTGAATACAACTTCCAGGTTGAGTACAAACCTGGAAGGTTGAATGTCGTGGCCGACGCGCTTTCGCGTCGACCAGAT
TATGCGGTGCAAGAGGCCGACGTACACCCTCGTCGTCCTTGTGGACGACGTGAAGGCCGCATACGCACATGATGCGGATGCGAAGCAATTGTTGGAGTAC
TTCTCCACACCTTCTGACAAGTCTCGTCAGAAGCTGGCCAAACACCTTCGTGCCCGTGTACACCGTTATCGTGTACACAATGGTCTGCTGCTTTACAGCG
CAGTCGACGACAACGCAGATCGCATTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTACGAGTACCACGATGCCCCGACATCGGGACATCC
TGGCCGTGAGAAGACATATTTGCTTCTCACGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAAGTACGTTCGTGCTTGCGAGGTATGCCAG
CGCGTGAAGCCTGCGCCCAACTCGCAGGCTCCGCTTCAATCACTACCGACTCCGTCGGAGTGCTGGCAGTCCATTTCAATGGACTTTGTTTTTGGTCTTC
CGCAAGACAACAAGCGGAGGACTGGTATTGTGGTCTTTGTTGACCGCTTCAGCAAGATGGTGCATCTTGCTGCAGTACCAGCCGAGGTGACAGCCAAACA
GACGGCATGTCTGTTTGTCGACATGGTGTTTAGACACCATGGTATGCCACTCGACATCGTGTCGGATCGGGATCCGCGCTTTACAGCGCGATTCTGGCAA
GAAGTGTTTACACTTCTTGGGACGCAGTTGTCCATGTCGACTGCGGATCACCCGCAGACCGACGGACAAACAGAGCGTGTCAACCGCGTGCTGGTTGACA
CCATGAAGAGCTACGCGCACTCGTTCCATCAATGGAGCGACTGCTTGCCGATGGCGGAGTTCGCCATCAACAACTCGGTGCATGTCTCGACAGGACACAC
GTTCTACGTGAATGCCATGAGGCACCCACGCGTACCGAGCGTACTCGGTGCGGTAGCTCCTTCCTTAGTGGGGGAGGATATCCGGTTAATTCAAAACAAC
CGGATAAGCACGCTGATACAAGCAATGTATCAGCTGTGACGACTCGCGCACGTACTGCGCGCAGTCATGGCGACGACAAGACAGTGTCTACGACGGGCGT
AGACACTTTAAACGACAACGAACATCACGCGCAGGCCGGGCCTGCTGCGAACAAGGAGCACGAACTGAACCAGGGGTTCAGCTCGGATGCAATGGACTTT
GTCCAGCGTCGACAAGCCGTAATTCGGTTTGTCCAAGATGCAATAGCAGCTTCTGTCGATCGACAGAAGCTGAATGCCGATAACACCGGCAGGGGAAACA
CAAATGAATTCAAAGTTGGTTCATTAGTTCTGTTAGCTACGCAGAACCTAGCTAAACATGCAGTTTCCGATTTCGGAGCAAGCTTGCTTGCTCCGCGCTT
CATTGGGCCATTCACCGTGTTGGCGAAGCATGGCAACGCGTACACACTGGACATACCGTCCAGCATGCGCTTGCACCCAACGTTTTACGTTGGGCGACTG
AAGCCGTACGTGCAGCACGAGTCACCTACGTCTGGTGACTCGCCAAAGCGCTCTCGAGCGCGGCGACGCGCTTCAAGGCGCCAGAGAGCCTCGTCCCGAC
CTCGACCTTTACGTTCGAGGTCGTCTGCGCAACCTCCGCGAGCTGAGCCTTCAACAAGCTCAGCTCCTGACGCAGAGCAGCGAACTGCGACGCTTGGAGA
CGCTCAACAGCCTCAAGCGAGACTCAAGGTTTGGTTGACCAAACCCGGGGCGTCTTCCCCCCCCCCCCACCCGTTGCGAGACGCACGCGGGGCAACTCGC
TGGATCGTCCAGCGAATTGTTGGTCATCGGAACCAGGACCGGCCGGTTCATTTTCATTCGTTGGAGAGGATTTCCTCCCCAACACGATATGTAATGGGTC
TGCTTAGACCCACTACTTAAGCTTACACGTGTGCACACGTGTATGAGGAAGCGTAGGAATAATTTACTTAAGTTCAGTATACTTGTATCCGCAAGTATAC
TTAAACCTAAATAAAGGAACCGAACGATAGCTTTGGTGCCAAATGAGAATGTATTGATTGTAAATGGGGTTTCCTCCTAAAACTGATATTTATAATGAGA
GGTTCTGCCATCGGATGGCTGGCAGAACCCCTATCTATTGAATGACTCTCATTGGTAGAAAGGTGTTACTTTCTACCAGTCATATGCCTTTTGCTATGAA
TGTGGACCACCCTGTGGAGTGGTCACCTGAATGTATTCCTTAGTGCATGTTGCACTAAGGTAGGAGGTGGACCGACTGTGTAGCCCGCTACACATAGACA
CACCAGCCGTGCGACCGCCGAGTGTGGGTGTACTTCGATCAAATCCACTACTGGTGTCAATATTTGGCTCAGCCCTCGTACAATATCCCTCTGTTGCGTT
ACTGTAATCGTAGCAGGGGCCTCAGTGACAGCCGTGTGTATGTCCAATGTAATATTTTTCCTTTGCCGGATGTACGCCACCACTGGGTGATCTGAAGGTG
AGGCCGTGAAGTGGACCTCTCGGTCATATGTGGTTCGTTCTGCCAGTTCCGAAAAATTGTATACAAGTAGCCGCACCATCTCTTCTGCGGAGTTCTGCTG
TTGTTCCCCCAAGGGTGTCCGTAAGAACATAAAGTCAATCCATCCATACGCTACTCGCTGCCACTGGACCACTTCCCTAGGTTGCAGGCCTGTTTGGGAA
ATCTTCATGCTCTGGCTAATGACCTGCGATGTCCTGTACCTGTATACACCTGAAGTTGCTGACATTCAGCGCACTGTAGCCAGTCTAGCTGTGGTAGGCC
TCTTTTTCATTTTTTGGCCTAGTGGTAGACTTAGCAATTGTCCTTAGAAACTCCGTGCAGTCAAGACTGAGTGAGCCTCCCGTCCATGAGGTGTACAGTT
CTCCTTCCTCAGAAGCCAGCATCACAAACTTTTCCATTCCCTCGCCCCTTGTGGATCCGCGGTACCAGCCTGTATTAGTAGCGTGCGTCCAGTTTTCCAC
AATGTCGTGCGTCTCTGGAAACCAGCTGCACTGGCGGGTGCAAATTTCCAGTAATATATATACTCTTGGAGCTAGTCCGGCCGCGTTGTTGTAAAAAAGT
ATATCTCCAACTACGTGTGTGTTGTGCGTTCCCCATTCAGCCCAGTTTCGCACCGTGACTGCCGCTTGTTGTTGGCTTTTGCTGAAAAGGTGAAGAACCG
GACGGAGGATGTCGCTGTCCTTTGCTCTGAGAAATTGGTATTGGGGGCTGTACCGTAATTGTTGACTTGAGGTGTGCTGGAGCAACTGCGTAGCGGGTAG
CGATCAGAGGTCGGGGTCAGACTTGAAACTCCAGACGAATCTCCCAACGCGTGACCTAGGCTACGAACGGGAATCTAGAGTTGAACAGGCCTTTATAAAT
CTACCACGGCTGATGCTGCCACGCATGGGCGAATACGCCCTGGTGAACGCGACATCCGGTCTTGAGACCGGAGCTCTTCCATTGACTTCGATCGCAAGCT
TGGAAAGGATGAAAGGATCCACATATTTGTTTACTTGGGTTCTGTGTGGAGGTTAGCTGGAGCCTTCGTGTATATATCATAGCTTGCGTGCTCAATAGGA
ACTCATGTATTAACTCCGCATTCGCAAAGAAGATTTGCATTTGAGCTTTGAAGAATTACAACTTAAACTTCACCTTCGTGGCTGCGAGCATGACGAGAGC
TTCTGAAGCTATTTGAGGTGTCGTATCTCAAGCTGGCGAAACTTGACGCTCATGCAGTTTCGCGGGCGATACAGCTGGTAAGTTGAATGGAAATACCTTA
GAAAATTCGGCTCAATCAAGTTTTACTAGTCTCTACAGCAATGATTTTAGTGTACACAGCCTCAGTGATTCGCAGCGAAAAGTGGCACATGGACCCCGTA
CCGAGCTTAACTATTCGATGCATACCTGTCAGGAGCAGAGGGAAGAGAATTTCAAAGCGAAGCGGCTTGCAGTATAAGCCGTCGTACGCGTTCACGGACC
ACTAGAGCCGACTGACTGGCGAGCGAGAAGTGATCGGGCACCCAATGCTGAAGACCCTTCAGGCGTGTTCGTGGCCAGGCATGGATCTGACTGCCATGGC
TGCAAATGGAGAAGGTGATGAAGCGGCGGAATCAAGCTTTGGAAACTGTGTGGTGGATTCTGGATCAAGCGCTTCCGCCGCCAGACGTGAACTTCAAGAC
TTACCAATAGACAGTGTGCGACTTGATGCAACCAGTCAATCACAGAAGGAGCTACGCCTGATCCTGGTGCATCAAGGTCAGCGTGCTTCCTTGGCGATGG
CAGAGCCAGACATCTGGCCTGACCAAACTTTCATGGATCTTGTAGAACAGGCCGCCAGTGATCCAAGTGGAATCGCGGGTTGCCTTACATGTTCCCTTTC
ATGCTGCCATCAGCATGAAGGTTCATACTTTCATTGAGAAGGATGGATGGTGACGACTGTCCAAATCTCTCACTCTTCAATTTGCTAGTTACATCACAAG
CTACCAATACACTAGGCTACAAGTTCCAGCAGGATCGCCACCTGTCGCCCGTGTTTGAGTTGCTTCAACCTCCGGAAAACAGCACAAAGAATTCTTTAGT
GGTACTGACGTACTACTCGCTCAAGTGGTACGACCGACCTACTAGCCGACGTGACCTGTCGTCATGCCGAAACGCCACGCTGATGATTCAAGTGACGAGG
AGGAGTCCTCCGAATACTCGAAGCCGATGCCTGTACCCATCTTCGCGCCGATTCTCCCACCAAGATGAGTTCCATTTCTCACAAGCGTGGTGAAGTGGGA
TAAGCTGCGCATGGAGTATGAGGCCAAGATGAGAGCTCGTTGCAGAAGCTCTGGCGAGGACTATAACTTGGTGACGCAGAACGTAAAGGAATCTTTCGAT
CTCCGTCTCCTAGAGACGTTCTGTGCGCTGAGACTTCGGAGGACGTCGCCGATGTCACCGAAGGACAACTCATCGCCGAGATCAAGCATCTACTAGGGAA
GGTCAAGAACGACCTGCCCGACATCAAGACCCTGTGCGCGAAGGAACTACGGATGGATCTGTCGGAGACAGACGTAGATGCCCGCGTACTGGCCTATTTC
AGTGTTTCCATGAAGTCGTCCTGGAGAACGGACTTGAAGAAGTTTTCTCCGGTGATTATGGTGAGAAGGATACGTGCAAGCGTTTGGTGTCGTGTTTGGC
CCCTCCGGTCCTGAAGGCCGATGTCAAAAGTGCCGTTCGCTGGACTAACAAGGAGGCTGGCAAAAACATTCAAAAGCGGTACACGCTGATCTACGAGAAG
GCTGTCGAACACGAGCGTCATTTCCAGCAAACAAGCGATGCGACTGATGGTGAAGGACAAATTCGCTCCCAAGTCTGCGAAGAACGTTGAGAAGTCGACT
ACGGCTCATTCGAAGAAGCGCCTCGTAACGATCTGGTAAGCGATCTGTCGAAGAATCCGACACGACGGTTGAGAAGATGATCGACCAGAAGATTACAAGA
CCTTTAACCGTCTATCTCGCCAAGAGCCGCCGTCGCCGTGCCCGAAGTGCCAAGATATGCACTGGCTCAGCGATTGCACGAAGGCAACTGACGCTGAGAA
GATTGTGCTTCGGCAGAAGCTTCGCGAAGCTAACAAAGCTCGCCAGTCTCGCGTGAAGAGATTGAAGAAGTTATGCCGCCGACCTCACGCACTGTGACAT
CAACGGCGTACTGGATTTGCCGTGTTGCCGGACACTGGTTCCGACTACACGGTGATCAGCCGTTCGCAGTGGAAACTATTGCTCGACGTGGATCCCTCGG
TGCAGGAGATTCCGTTGGAGACGCCGTGTGCAGCCAGTCGTATGATGCACACCAGTCGTGGCTGAGAAGAAAGCCATGCTCATGTCCTGATTCACACGGC
TGCTGGACCGGTGCAGCCAGTGGAAGATGCCGTGTCTGATTGTGGATACGGACGTAGACGAATTCATTATTGGTCAAGACCTGTTGATCGCCCTGGGTAT
CGATGTGGATCGGCAGCTTGAGCAGCTCGCCTCCCATCACGAAGACGATACCGGTGGTGATCCATTTGATTTGGAGGCGGACGACGCCCCGTGAACCGAA
GTCATGTGGCTTCTGATGAAGAAATTCGTGCTGCAGTCGAGACTCTAATTGAAAGAGCCCTGGAGCATAAATCTCCACCCGAAAACGTGGACAAGTTGCG
AACCATCGTGCACATGTACGATGTGTGGCGCCTGGAACCCGTGACGATCCACCTACTCGCGTTCCACCGCTCGAAGTGCGTTTGAAGGATGGGGCTCAAC
CATGCAAATGTAAGCCTCGCAAGTATCCTCCACATGTTCGCCAATTTTTATGTGGGTTTAACGACCAACTTGTGACACTAGGATGGGTCTACAAACTCAA
CAAGTCGCTGGGCAAGCCCCGTTCTCCCCGTCAAAAAATCACAAGAGCCCATGGATTTGCAAATGACCGACTATCGCGAATTCAACTCAATGACCGACAT
CATGGCTGCCGTAATGCCGATTATTTCCTTGGTAATGGAAAATGCACGTGGAAAACAACATTTTGGACTTTTCGACTTCATTAAGGGTTTCTGGCAGCTA
CCTTTAGCTGGGCCTGCCAGGAGTGGTTATCCTACATGACTGATGAGAAGATCTACACTCCACGACGCGTACCACCAGGCTGTGGCGACGCTGCTATCTA
TTTCCAAAAAACTATGGAGGCGTGCTTTGCGACGCTACTGTCAGCACCTCCTCGTGTGGATCGACGACCTGTTGCTCTGCGCGGACGACAGACACTTACC
TGGGCAAACTCGCTGAGTTATTTTCGTTGCTGAATGATTTTGGCCTCAAACTCGGCGTGAAGAAATCCAGCCTGTATCAACAGGAAGTGAAGTGGTGTGG
CAAAATCATCGACGCCAATGGTGTGCGCCATGACCCCGCCACGATTGACTCACTCCGTGCAATGTCGTACCCCAGTACAGCAGGGGAGTTGCAGCAGTTC
TTGTGTGCAATTAATTGGATGCGAGGCAGTCTCATTGACTATGCTCGTCAAGTCTCTCCACTTCAACACCGATTAGATGAAGCTCTGGCCAAGACACGAC
GCACGAAGCGTGTGGCTGCTGGAATTTTAATTGAGCTTAGTGCAGCAGAGAGATCTTCCTTCGACATTGTGAAAGACATGCTAGCCTCAGCGGCTACGCT
TGCTTTCCCGAATGACTCAGCGACGACATGTCTGCTTCGGATATTGGGTGGGCCGTCATTGTGACGTAAGTAAAGGACTTTGACATCAAAGTGCCTGTCC
AGTACCAACAACACCAACTCGCCGAGTGTTTAAGTGGCACCTTCACGGGTAGCCAACTCAATTGGACAGTGATCGAAAAGGAAGCTTTCCCTATCGCACT
GGCCTGTGACAAACTGGATTATTTGCTGCTCCGACCGCAAGGATTCAGGATGTTCTGCGATCACCGCAACTTAATCCACGTGTTGGCTCCTGACGAGCAT
GTCAAAAAGCACGTGAAAGGCAAGTTGTTGCTGTGGTCCATGCAGTTGATGAACTACAACTATGTGATCGAACATATCGCCGGCCCGAACAACGTCTGGG
TCGACATGATCAGCTGGCAGCCACGTCCCAGCCACCAGCAGAATCAGCCGGATTCGAGCTGACACGCCGGCGGCGACAAGCGCTGCATCTCAACAGGAAC
CAGCCAGGGAGGTGACGGGGCCGACCATCTCGACGCTCCGCCCTCTTGATGATAAAAATTTCATCTGACCGACTTTTGTGGAGATTATCCTGGTGTAATC
ACGTTATGAACCACCACCTGGAGTTGTGCGTACCGACGGCGACGTATTCACGCTCCGCGACCAAATTTGGATCCCTACTGAAGCTAGTGATCTCATCTTA
CGACTATTCATCATTGCACACTGTGGTGCTCAAGGTCACGGTGGCCACGCTGCCATGGTGGAGCACCTTCGACGAATGTTTGCGATTGAGAAGCTCAACA
CCCTGGCGTCCACCTTTGTCCGCCAGTGCCGGTTGTGCCTGCATTCAAAAGGGGGGCCATCATCCCCAGACCTTGGGTGAAACAGTTGATTGTTGTGAAC
GCAATCTAGTTTTACATTTCGATTTCCTGTTCATGGGTGATAGTTTGGCGACTCCAGGTATATCCTAGTGCTAAAGGATCATGCCTCGTATTTCTGCGAG
CTTGTCGTGGCAGATACAGCTGACAGTACTGTGACCTTGGAGGCGTTCCTCACCTGGCACTCTCGTTTTGGCCTGCCACCAGTTTGGATCTCGGACCAAG
GATCTCATTTCAAGATCGAAGTGGTGAGTGAGCTGTCGCGCAGGCTGCGCACGCAGCAGCAGTTCGCCCCCGCCTATTGCCCGTGGATAAACGACTCAGT
GTAGCGCGTGAACCGAGATATTCTCCAGGTGATCAGGACAATGATACTGGAGTACAAGATCAACCACAGCGACTGGGTGTACCTGGTACCCATGGTACAG
TCCAGCCTCAATCACACTGCAGTACCTTCACTCGACCACAAAGCGCTGTTTACTGAGCTACCGTGCCCGAAACCTCTCAAAGAATTCTACCTGCCTGGTT
CGGGGGAGATCAAGGAGGCGCCAGCGAGTGGCAAGATTGATGACTTTCTCGTCAACCTGCGAAGCAGTATTCAAGACATGCACAAAGTAGTTGAAGACCA
ACGACTGAAGCAGAGACTGCTGAGCAAGAAGCGGGAGCGAGGAGAGAACATGGTGAACTTCATGGAAGGTGATTATGTGTTACGCTCACGAGTAGCGGCA
ACAAGTTGCTCGTCACCTCGGTAGGGGCGTATCCCGTGCCGATGCACACTCTTTCATGGTTCAACACCTCATCGCGGGTGCCGAGTTGAACGTGCATGCC
TCTAGACTAAAATTCTATGCAGACTCCAGCTTGGACATGACCAAAGAACTGCTCGAGCACATCTCGTCCCAAGGAATCATCTTGGCGGTGGAGAAGCTCA
AGGAGCATCAGTG
	
	
TGTCGCTCCCAGTCACAAGCTGGAAGCGTTTCGCTCGCGAACTGCACGATGGACGCATCGAGCAGATCTGCATCCTCTCGGACGTCGAGAGGATGACGTG
TGAAGCAGAAGAGCTGAATCAGCTCATCTCTGAGGGCGCGGACGCCCTCAGCGCGAAGTCGAAGAAGGAACGCTTCGACGAGCAAGGCTGGGACTCGCTC
AAGGCGAGCCCCTTTTACAAGGTCTTGCGTGAGTACAAGGATGTACTCCCGGACGACATTCCTGCGGAGTTACCGCAGGACAAGGGTGTTCAGCACGAGA
TTGATCTCGTGCCGGGAACGAAGTACTGCGTCACGCGACAGTGGCCACTGCCGCGTGAGCAAGTCAAGGCAATCGACGACTTCTTTGAAAGTCGTCGCAA
TGCAGGACAAGTGCGGGAATCGAAGTCCCCGCACAGCGCGCCTACGTTCTGTGTGAAGAAACCACAGGGCGGGTGGCGCATCGTTCATGCGTACAACAAG
CTGAACGATGCGACGGTACCGGCGCAGACGCCGATACCTCGAAAAGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGTACTCTGGATCTGA
GAGACGGGTTCTATCAGATCCTCATGCGTGAGAGTGATATCCCTCTCACGCGGTGCGTCACGCACTTGTTGCGCTCGGTGCGCGACTTCGCACCGAGCTA
TTTCGACGACGTGTTCATTCACAGCCGGGCTGTGAATGGGAAATCGGATGTGGAGATGCATACAGAGCATCTCCGCAAGTTGCTTGAGCTCATGCGAAAG
CACAAGCTCTACGCGAACCTGAAGAAGTGTATCTTCGGGGCGACCGAGATACCCGTACTTGGGTGTCTCGTGGGGAAGAACGGCGAACTGCGGCAGTTCC
TTGGACTCGCCACGTACTTGTGCAAGTACGTGAGCAACTACGCGGGCAAGATTCGCCCGCTGTCGCAGCTCTTAAAGAAAGAGGCTGCATGGGAATGGAC
TGCTGATTTCGACGACAACGCAGATCGCATTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTACGAGTACCACGATGCCCCGACATCGGGA
CATCCTGGCCGTGAGAAGACATATTTGCTTCTCACGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAATCATGGCGACGACAAGACAGTGT
CTACGACGGGCGTAGACACTTTAAACGACAACGAACATCACGCGCAGGCCGGGCCTGCTGCGAACAAGGAGCACGAACTGAACCAGGGGTTCAGCTCGGA
TGCAATGGACTTTGTCCAGCGAATCTTTCGATCTCCGTCTCCTAGAGACGTTCTGTGCGCTGAGACTTCGGAGGACGTCGCCGATGTCACCGAAGGACAA
CTCATCGCCGAGATCAAGCATCTACTAGGGAAGGTCAAGAACGACCTGCCCGACATCAAGACCCTGTGCGCGAAGGAACTACGGATGGATCTGTCGGAGA
CAGACGTAGATGCCCGCGTACTGGCCTATTTCAGTGTTTCCATGAAGTCGTCCTGGAGAACGGACTTGAAGAAGTTTTCTCCGGTGATTATGTGGAAGAT
GCCGTGTCTGATTGTGGATACGGACGTAGACGAATTCATTATTGGTCAAGACCTGTTGATCGCCCTGGGTATCGATGTGGATCGGCAGCTTGAGCAGCTC
GCCTCCCATCACGAAGACGATACCGGTGAATTCTACCTGCCTGGTTCGGGGGAGATCAAGGAGGCGCCAGCGAGTGGCAAGATTGATGACTTTCTCGTCA
ACCTGCGAAGCAGTATTCAAGACATGCACAAAGTAGTTGAAGACCAACGACTGAAGCAGAGACTGCTGAGCAAGAAGCGGGAGCGAGGAGAGAACATGGT
GAACTTCATGGAAGACTCCAGCTTGGACATGACCAAAGAACTGCTCGAGCACATCTCGTCCCAAGGAATCATCTTGGCGGTGGAGAAGCTCAAGGAGCAT
CAGTGA
	
	
CRSQSQAGSVSLANCTMDASSRSASSRTSRG_RVKQKS_ISSSLRARTPSARSRRRNASTSKAGTRSRRAPFTRSCVSTRMYSRTTFLRSYRRTRVFSTR
LISCRERSTASRDSGHCRVSKSRQSTTSLKVVAMQDKCGNRSPRTARLRSV_RNHRAGGASFMRTTS_TMRRYRRRRRYLEKM_SSIR_PRVLSSVLWI_
ETGSIRSSCVRVISLSRGASRTCCARCATSHRAISTTCSFTAGL_MGNRMWRCIQSISASCLSSCESTSSTRT_RSVSSGRPRYPYLGVSWGRTANCGSS
LDSPRTCAST_ATTRARFARCRSS_RKRLHGNGLLISTTTQIALSCRMIMS_SSRSRTSTTMPRHRDILAVRRHICFSRVTSIGVTSTSGYAIMATTRQC
LRRA_TL_TTTNITRRPGLLRTRSTN_TRGSARMQWTLSSESFDLRLLETFCALRLRRTSPMSPKDNSSPRSSIY_GRSRTTCPTSRPCARRNYGWICRR
QT_MPAYWPISVFP_SRPGERT_RSFLR_LCGRCRV_LWIRT_TNSLLVKTC_SPWVSMWIGSLSSSPPITKTIPVNSTCLVRGRSRRRQRVARLMTFSS
TCEAVFKTCTK_LKTND_SRDC_ARSGSEERTW_TSWKTPAWT_PKNCSSTSRPKESSWRWRSSRSIS