Scaffold : scaffold_1
Gene_id : Phyli_Pl_113143
Description : conserved hypothetical protein
TGACTTCGAACGGTGGGTTTGGAGATTACGCCGGCGGGTTTTACAACTGCCCCAACAACGGTGACATGGCGTCCAAGAACGATTTGAACCACGCACTGCT
GCTTGTGGGCTACGGCACCGATTCTTCTGTTGGAGACTATTGGATCCTCAAAAACTCGTACGGCAGCTCGTGGGGAGACAGCGGCTTCATTAAGTTAGTA
GCAGACGCCAAGATCAATTGTGGATTGAACGTCTTCCCCGTAATTCCAACCGGTGCGAAGGCCGGTGCTCAGGCGAGTACGGCTATCGATAGTGGCGGTT
GACAAGATTTTCGTGGGACTGAGTCCAACGGCATGGATCATTGTTGCTGCGGCGACTACTGTCTTCACGATGATAACCACAGCCATAGGTGTGTTTGTTT
CGCAACGGAAGCTGAAAGTGTGACAAGATTTTCGTGGGACTGAGTCCATCAGCATGGATCGCTGTTGCTGCAGCCACAACCATATTTACATTGGTCACTA
CAGCGATCGGCGTGGGAGTTTCCCAGCGGAAACTTAAGGTGCTCCGCAAGCAGAATTCAGCCATGTACGCTGTGCCACCCCAGAATGGAAACTAGGACAA
ATGTTTATGAGATTTGTTTGAGCAGTGCACGTTTCTGCCTAATCACAAACTACCGAACAGTAAAAAGATGTGAAAGTGAATGCTGACACCCTATTCTAGC
CATAACCAGGTCTGTTTATCCGTCCTTCATGTGTTCGTGAACGTGATTGAGAATCCAGGCATCAGATGCAACAGTGCAGTCGGCCATGATGTTTTTCAAC
TTGGTGTCGTCCCATGCATGCGATGATTCAAGTGACCGCATCCCAATCCTCCTATAATAACCTGGTTCACGTCACTTAACCAGCGATTCATTGGTTGCTC
GATGGTGGTTGGCGACTGAAAGTCCATCGTTGCTTGACGAAATGACTTGACCAGTCGACATCTTGGACTTTGTATGGTCGCGCCTGCAATCAAACGATTC
GGATGAACAACAATCGCATCTGCCACTTGCAGCGCAGCGGTCATTTCCGGCTCCACCTGCAGCAGTTCCACCTGCTAGTAGCCTCTTGACAAGATGGTGT
CGTCGTGGACCAAGTTGCTGGCGCTGGCGGCCGTTTCGATGCTTCAAGCGCAAGGTTTTCCTACCTTTGGCACATTGTTGAGCTGCGACGCCAGGCGCTG
CTTGTGGGCAGACCGAGATGGCGTCGCAGTGCCTTCAGACGCAATGGTGACGCAGTTCCTACAGGACAAAGGGATGGCCACAGGTCCGAGCGAGTTCCGA
CGTCGCATGGAAGATCGCGTAGAGTACTTGGAGCAAGTGCACAAGCACGCAGCAGACCGAGACTGGGCCTTTTCGTACGCAATGGGCGTCAACGCTCGTC
ATTTGTATCATGATGGCGATCGGAGGTTGTCACCGTTGGAGTTCGTACAACAGGAGCATCGGGCGGCGCAGCGGCAAGAGCAACGCAGACTCACAGAGCC
GCGTAGACTCGCGAACTCGACACTTGGTTACCGTGAAACATTGGATTGGTGCTCAACAGACAATACGCACAACCATAGCATTTGCACTGATGTCAAGAGT
CAGAATCAATGTGGCAGTTGCTGGGCCTTTGCGGCTGCAGATGTCATTGAGACGGCTGTGGTGGTGAATTCAGGAACTGCGCCGCAGTCATTATCACCGC
AGCAGTTCTTGGAATGCAGTTCGAGAGAGATGACAGCTACTTTTGACTACTGCTGGGCTGAGGGCGGCGTAGATGGATCGACGTGGCTCCTCCCGAAGAT
GATATGGGGCTCGAGGAACAATGCTTGTAATGGAGGCATGACTCATGCTGCATTTGCTGATGCGGCGCAATTGCACTGGTCGCTGTTGAGCCAACTTGAC
TTGCCCTACAACGAGGAGGATACATCCCAAGCTTCCGCCGCAACTCTTGCGAACGCGTGTGATAACACGACAACAGACAATGCCGCTGCAAGCATCACTG
GGTGGGAGCAAATTGTTGGACCCTCGTGTGATAATAGTAGCGATCCCACCGAGTTACTCAAGTTGGCACTACAACAACAGCCTGTCTCGGTAGCCATCAA
CTCTGGTGGGTCTTTCGATGCGTACAAAGGTGGAATTTACTCGTGTCCGAACGATGGAGACTTCTCTACCAGTGGCGACATTAACCACGCAGTCGTGCTT
GTCGGCTACGGCTCGGATGGCACTACAGATTATTGGATTATCAAGAACTCGTACGGTGCATCATGGGGGGAAAAGGGGTTTATTAGGCTCGCCATCGACT
CGAAGATTAATTGCGGGCTCAGTGTTTTCCCCGTGATTCCTACTGGAGCATCAGCAGGTGCTGTACACACTGTTGTTGATGGTGGAGGTGAAGTCGAATT
CGTTGGGATGTCTCCAGATAGCTGGGTTATCCTTGGTATTATCGTAGCCGTCGTCACGCTTTTCCTCACCGTCATCGGCGTCATCTACGCCAGTCGCCAG
CGCAATGCTTTCAAGGAAACGCTGTAAATTACTTCAAACTATCATCCCCGGCAAGATAACTCGTTGACCATGAATATGTAAGTCCTAATAACAATTTCAT
CAGTTCCAATGAAGTCGCAGGAAGCTGTCATCTTTATTCATTCTGTGCATCCCTCTGGTAAGGTATCACAATCGTATAAGCTGTGTGATAGACATGGAGA
TTATCGACGCCATCGGACTCGAGACGTACAACCATCATGCAGGTCAGGAATTCCAAGTGTCTGAACTCGTCCAAGGAACACCTTCCGATGTCTTTGACGC
ATGGATTCGTGACGTCTGGTTGGCTGGTGGGGACCAAATCCACGAAGGCATCGGCCGTGGTTACATCGGCAGCATACGTCGTGTACCACTAGGTGTGGAA
GAAGAGATCCTATCAGCAGGATTACCTGAAGAACCTGCAGAAGGCCAAGAGGAGAGTCCCAAGATCCCGTCAATATGCTATCGAGTGCGCAAACCCGGTC
CGTTCCCTCTACAAAGCCACCTAGCTATGGTGCGTTTTGTCAACAAGACATCTACATCTGCTACGACACTTGTAGTGTGGACGGTGAAGACGGAGATGTC
TACTATGTGCAATTCCCTGCATTGCGGCGGGTTGATCCGCTTGATATTCCGCACTGCGTTGAAGACATTTCTACCATCACTAGCCAAGAAAGCAGCCAAG
TAAGCACCTCACAGCTCTGTCATGATGAGGATTTAGCTCCATTTTATTGGCCAAATATCCGTTTCCAACACTAAATAGGGGGGGAATGGAGCGGAATCAC
TTGGACCCAACGCGATACGTGGACGCGCAGGCTTTCGAGAAATACCAGCACTACAAGGGTCAGGAGCTCGTGGTGTCAGAGTGCGTCGTTGGTTCTCCAT
CCGAGGTGTTCGATGCGTGGCTAGAGGAAGTTTGGGTGGCCGGGGGCTCGGAACTGCACGAGGGTGTAGGTCGAGGCTACGTCGGTCACGTACGAGGCGC
TCCACTAGGCATTGAGGAGGAAATCCTGTCGGCCGGACTACCTATTGACGAGCCCGTGGACAGCGATGGAGGACGACCGAGTCTCGCTGCAGCTCGACGA
GACCGTTCCAAGATCCCCTCGATATGCTACAAGGTCAACAAGTTCGGACTGTTCCCGATCCAGGACCACCTCGCATTCGTGCAATTTGTAGACGTTGCTG
CGTCTCCAGAGAGCACTCCAGCGACGCTCGTCATCTGGTCGCTCAAGATGGAGCCGTCGATACTGGGGTATCTGTTGTGCTGCGGAGGATTCGCCAAAAT
CGTCCTGCGTTCTGCGCTGCAGGGTTTTCTCAGCACGCTGGCAGCAAGTGCTGCAACCAGAGCAAACCGACATCTAGAATA
	
	
TGACTTCGAACGGTGGGTTTGGAGATTACGCCGGCGGGTTTTACAACTGCCCCAACAACGGTGACATGGCGTCCAAGAACGATTTGAACCACGCACTGCT
GCTTGTGGGCTACGGCACCGATTCTTCTGTTGGAGACTATTGGATCCTCAAAAACTCGTACGGCAGCTCGTGGGGAGACAGCGGCTTCATTAAGTTAGTA
GCAGACGCCAAGATCAATTTGGCGGTTGACAAGATTTTCGTGGGACTGAGTCCAACGGCATGGATCATTGTTGCTGCGGCGACTACTGTCTTCACGATGA
TAACCACAGCCATAGACCGAGATGGCGTCGCAGTGCCTTCAGACGCAATGGTGACGCAGTTCCTACAGGACAAAGGGATGGCCACAGGTCCGAGCGAGTT
CCGACGTCGCATGGAAGATCGCGTAGAGTACTTGGAGCAAGTGCACAAGCACGCAGCAGACCGAGACTGGGCCTTTTCGTACGCAATGGGCGTCAACGCT
CTGTGGACGGTGAAGACGGAGATGTCTACTATGTGCAATTCCCTGCATTGCGGCGGGTTGATCCGCTTGATATTCCGCACTGCGTTGAAGACATTTCTAC
CATCACTAGCCAAGAAAGCAGCCAAGGGGGGAATGGAGCGGAATCACTTGGACCCAACGCGATACGTGGACGCGCAGGCTTTCGAGAAATACCAGCACTA
CAAGGGTCAGGAGCTCGTGGTGTCAGAGTGCGTCGTTGGTTCTCCATCCGAGGTGTTCGATGCGTGGCTAGAGGAAGTTTGGGTGGCCGGGGGCTCGGAA
CTGCACGAGGGTGTAGGTCGAGGCTACGTCGGTCACGTACGAGGCGCTCCACTAGGCATTGAGGAGGAAATCCTGTCGGCCGGACTACCTATTGACGAGC
CCGTGGACAGCGATGGAGGACGACCGAGTCTCGCTGCAGCTCGACGAGACCGTTCCAAGATCCCCTCGATATGCTACAAGGTCAACAAGTTCGGACTGTT
CCCGATCCAGGACCACCTCGCATTCGTGCAATTTGTAGACGTTGCTGCGTCTCCAGAGAGCACTCCAGCGACGCTCGTCATCTGGTCGCTCAAGATGGAG
CCGTCGATACTGGGGTATCTGTTGTGCTGCGGAGGATTCGCCAAAATCGTCCTGCGTTCTGCGCTGCAGGGTTTTCTCAGCACGCTGGCAGCAAGTGCTG
CAACCAGAGCAAACCGACATCTAGAATAG
	
	
_LRTVGLEITPAGFTTAPTTVTWRPRTI_TTHCCLWATAPILLLETIGSSKTRTAARGETAASLS__QTPRSIWRLTRFSWD_VQRHGSLLLRRLLSSR_
_PQP_TEMASQCLQTQW_RSSYRTKGWPQVRASSDVAWKIA_STWSKCTSTQQTETGPFRTQWASTLCGR_RRRCLLCAIPCIAAG_SA_YSALR_RHFY
HH_PRKQPRGEWSGITWTQRDTWTRRLSRNTSTTRVRSSWCQSASLVLHPRCSMRG_RKFGWPGARNCTRV_VEATSVTYEALH_ALRRKSCRPDYLLTS
PWTAMEDDRVSLQLDETVPRSPRYATRSTSSDCSRSRTTSHSCNL_TLLRLQRALQRRSSSGRSRWSRRYWGICCAAEDSPKSSCVLRCRVFSARWQQVL
QPEQTDI_N