Scaffold : scaffold_1
Gene_id : Phyli_Pl_113120
Description : conserved hypothetical protein
ATGGTTCGCCGATTGCTGCTGCTGCTCGCGACGCTGACCTGCCTCAGTTGGGTAGGTGCGACTGGCGATGGCGTGTCTACAGCTGTGCGTCTCGTGACGA
TCCACCCGCACAATACCAGCGCCTTCACGGAAGGCCTCGTGTTCGACGACGGCGCGCTTATAGAGTCCACGGGGCTCAATGGCAAGTCCTTTATCCGCAA
ATACAAGCTGTCGGACCTCAATTCCGACTATTTCAAGACGGGGGCTACGCAGGCGGTGCCGTTCCTCAAGGAATTCCGCTTCGACGAATCCGTCTTCGGC
GAAGGCGTGACCGTCTTGGGCGACGTGCTATTTGCGCTGACATACAAGGCGCAGCAGATGCTGGTGTTGTCTCGATATGACTTCCAGCTGCTTGGTCAGT
TCCCCCTCACAACATCCACTAACGAGGGCTGGGGACTCACGACAGACGGAGAATTTCTGATTGCAAGCGATGGATCCGCCAACGTGCTCTTCTTCGATCC
TCGTGACGACTTCAAGCTGCATCACAATATCACTGTGCAGAAGAAAGGCAAGGCAGTGACCAATGTGAACGAGCTAGAGTATGTAGAGGGGGAGCTGCTC
GCGAACGTGTGGTTTGAGAACCATATCTTACGGATCGATATATCCACTGGAGACGTGCTAGAGCAGATTGACCTAGATTGGATACCGAACATGGTACCCA
ACCTCCATACGGAAGCTATGAAAGCCTCTCCGTTCAAGCAAGACGCTGTGATGAATGGAATCGCGTATGACCCGGTGACGCGTCATATATTTGTGACCGG
CAAACTATGGGACTCCATGTTTGAGCTCGAGCTGTCATATCTGACTTCACACAAGCGTGCAATCGTCCCTT
	
	
ATGGTTCGCCGATTGCTGCTGCTGCTCGCGACGCTGACCTGCCTCAGTTGGGTAGGTGCGACTGGCGATGGCGTGTCTACAGCTGTGCGTCTCGTGACGA
TCCACCCGCACAATACCAGCGCCTTCACGGAAGGCCTCGTGTTCGACGACGGCGCGCTTATAGAGTCCACGGGGCTCAATGGCAAGTCCTTTATCCGCAA
ATACAAGCTGTCGGACCTCAATTCCGACTATTTCAAGACGGGGGCTACGCAGGCGGTGCCGTTCCTCAAGGAATTCCGCTTCGACGAATCCGTCTTCGGC
GAAGGCGTGACCGTCTTGGGCGACGTGCTATTTGCGCTGACATACAAGGCGCAGCAGATGCTGGTGTTGTCTCGATATGACTTCCAGCTGCTTGGTCAGT
TCCCCCTCACAACATCCACTAACGAGGGCTGGGGACTCACGACAGACGGAGAATTTCTGATTGCAAGCGATGGATCCGCCAACGTGCTCTTCTTCGATCC
TCGTGACGACTTCAAGCTGCATCACAATATCACTGTGCAGAAGAAAGGCAAGGCAGTGACCAATGTGAACGAGCTAGAGTATGTAGAGGGGGAGCTGCTC
GCGAACGTGTGGTTTGAGAACCATATCTTACGGATCGATATATCCACTGGAGACGTGCTAGAGCAGATTGACCTAGATTGGATACCGAACATGGTACCCA
ACCTCCATACGGAAGCTATGAAAGCCTCTCCGTTCAAGCAAGACGCTGTGATGAATGGAATCGCGTATGACCCGGTGACGCGTCATATATTTGTGACCGG
CAAACTATGGGACTCCATGTTTGAGCTCGAGCTGTCATATCTGACTTCACACAAGCGTGCAATCGTCCCTTA
	
	
MVRRLLLLLATLTCLSWVGATGDGVSTAVRLVTIHPHNTSAFTEGLVFDDGALIESTGLNGKSFIRKYKLSDLNSDYFKTGATQAVPFLKEFRFDESVFG
EGVTVLGDVLFALTYKAQQMLVLSRYDFQLLGQFPLTTSTNEGWGLTTDGEFLIASDGSANVLFFDPRDDFKLHHNITVQKKGKAVTNVNELEYVEGELL
ANVWFENHILRIDISTGDVLEQIDLDWIPNMVPNLHTEAMKASPFKQDAVMNGIAYDPVTRHIFVTGKLWDSMFELELSYLTSHKRAIVP