Scaffold : scaffold_1
Gene_id : Phyra_g12089
Description : hypothetical protein
ATGATCGAGCCGAAGACGCCGCCGATCACCGAGTCGGAGATACCAGATGACGACGAAGTCTGTTACCATGAAGGAGGCGACTTGTTCGCGGAAGACGTGG
AAAAGCAGATGGCTGTCTTGCCTGAGGTAGCAACCACTACCGACGAAGTCATGATCGAAGACATTCAGGTGGGAGACCCTGATTTCAACACCCCTGAGGA
GGTCGATCGTCTACGACAAATCATCTGGCGCCGGCGTCACCTACTGATCGGAAAGGGAAACGCGTTACCCCCGGCGGCTGTAGGCGCGGTGTGCGACATC
GACGTTGGGGGAGCAACTCCTGTCGCCCAACGCGTTCGCCGGGTCGCCCCACAGTTTCGCGAGAAGCTGTCGGACCTGATCAAGAGTTTGCTGTCTGCGG
AGATGATCGTTCCGTCAACCTCGCCGTGGGCATCACCGATCGTGATCATCATCAAGAAGAACGGTGTTGACATCCGACTCTGTATCGATTACAGGCTGGT
GAACGGATTGACACGACTGATGGTATATCCCATGCCGATGATCAACGATCTCTTGGAAGATTTGGACAAGGTGCTCTGGTACTGCTCCCTCGATATGGCC
AGTGGTTTCTGGGTGGTGTCAATGACTGAGCGAGCTCGGAAGATCTCTGCCTTTGTCACGCCATTCGGACTTTTCGAGTGGACGCGCATGCCTTTTGGGC
TGAAGAACGCCCCACAGATTTATCAGAGACTGATCGACAACGCGCTGTATGGACATCTCCGAATCCGCGCCGGTCACGACCCGTCGAAGCCGATCGACGT
GTTCGAGGCAGGGGAACCAGAGCCGGAACTGAAGCCGTCCGTGCTGGGAAGATGGTCGTACATCGACGACATTCTCGTTACGGCGACCACTAGGGATACT
TTATGTGAAAAGGTTGAGAGGTTGTTGGACGCTTGCGAACGGTGGAATCTGTCGATCAGCGTTGTCAAGAGCTTCTGGGGCCAGCGCAAGGTGGGTTACT
TGGGCCATCAGGTGTCTGCTGATGGTTTGGAAGCTCACCCGAAAGACTTTGAGGCGCTGAGTAATCTCCCCTTCCCGCTGACGCTGCGATCGATGCAGGC
TTTTCTCGGAAGTTTGAACTACTACAGTCGCTTCATTGAAGACTTCGTGATCTATGCCGCCGGCTTGTACGAGCTGCGCGAAGCGGACTTTCATGAGATC
AGCCGCCTAGAGAGGATCAACCCTGACCAACAAATGACTGGGGGCGACGAACCACAGATTCCGGACGCTGATCGCTGGACCCGAGCGAAGATTGCATTCA
CAATGTTGAAGGCCAAAATCGTGTCCACACCGATCCTGAAGCATTTCGATCCCGATCGCACTCCAGTGATCGTGGTCTACGCGAGTCAGTGGGCGATATC
TGCGGCACTTGTGCAAGAGCATGATGGCGTGTACTGGCCAGTAACTTTCACCAGTTGTACTTTGAAGTCCAACTAGCTCAACTACGGAATCGTCGACAAG
GAAGTCTTGGCGCTTTTACGGATGCTGGACGTGAATTACACCTTGCTGACGACGAGATCGATCTTGGTGTTGTCCAGGCACTCGACGTTGGCTTGGCTAG
TCAACTCAGCCGGTTTCCAGGGAAGACTCGGCAACTGGGCTGCGCTGCTCTCAGAGTGGACGTTAGAGATCCGGAAATGCACGAAAGGGGAAGATGAAAT
CCTGGGCGTGACTGCAGCAAGCATCACACCTCGCGCTGAAGTAGACGAAGCGCTGATCGCGATTGCGCCGGTGAAACAGCCTCGACAAACAATCCTCATG
CCACCCCCTACGGTTGAAGCGGACGAGAATTTGTTAGTCGCGAGCTTCGATGGATCAGCACGTGTTAAACGTAGCGGTGGGGCTTACAGCGCGATCATAT
GGAAGCTCCCCGAGTGGACGATTTTGTTAGCCGCGTCGGAGTACATGCCCGATCTGACCGTGAACGAAGCTGAGTACCGCGGGTTGTTGCTGTGTTATGA
TCTGCTGTCGACTTTGGACCGGGGGCGGATCGTGATCTGCGGTGATTCCAACCTGGTGATCCGCCAGATGCGTGGTGAGATCGCGTGTAAGGCGACAGGC
CTGTTGCTGTTGCACCAAAAGGCAATGGAACGGCTCAGATCGTGGCCGAAACACGAGTTCCTGCACATGAAGCGAGACTGGAATCAGAGCGCAGACAAGT
TAGCGAGCGCCGCTCTCCAACGAGAAGCAGGAACTGTGATTACCTCAGAGGATGATCGGCAGGACTTGGTCACGCTTAACCGTCTGGATGAGCTTCTCAA
GCCGAAGGATGACGACGGTATTGTCCGTGTGTCCGCGGTGACTAGATCAACGCGGCGTCGGCGATCGTCTCCCTAGGCTCTGCAGGAAACGATCATTCAG
CGCATGCGAAGTGAGCGAGTTGTCCAAGCCCAGAATGAGGAAGAATGGATCACCGACCTAAAGGCGTACCTGAAAGGAGACGTCGGTAGCTTGACCGCGA
AGGAAGCCAAGTCGTGTGCTAAGATCGCGGACGAGTACGAGCTGGATGAGAGCGACTTGTTGCTCTATTGTCCATCATCCATGAAGCAGGACGAGGATCG
GGATGTTATCGCAAAGTTGGTGGTCCCAGAGACTCTGCAGCAAGATTTCTTACATCACTATCATGCGAGTCTGGAAGGAGGGCATCAGGGGATCGGAAGA
ACGTACCGACGAATCCGATCGCATTTTCACTGGAGAGGTCTGTACCGAAGTGTCCAACGCTACATGGGAGAGTGCACAGACTGTGAGACAGGGAAAGGGC
GACCCTTCGTGAGAGGAGAGTCCCCTGGAAACTTGCAAGCGACGTACCCGTTCCAGATTGTCGCGATGGATCACATTCCGTCGTTGCCCAAGTCCTTCAA
GGGCAACACGGAGCTACTGATCTGGGTAGACCTGTTCTCGGGATATGTGATCGCGAAAGCAAGCGCGTCAAGGACGGCCCAGACGATCGCGGAGAATTAT
GAAGAGTGTGTATTCCGCTGTTTTGGAGCCAGTGAAGCCATTCGGCACGACAGAGAACCCGGTTTTATGTCTGATTTCTTCCGTGCATTCAGCCGGATCG
TGGGACAAAAACAGAGGGCCACGATGGCGTACCGGCCCCAGGCAAACGGAACAGCCGAGCGTATGGTGCAGACGTTGACTCGAGCGTTGAAGATGTACGT
CGCAGACGTTAACCAACAGGACTGGGACGAGTACGCAGAACGCCTCACATTCGCAATCAACACGGCCCACGATCGTGTGCGTGGAGACACACCGTTCTAT
CTGATCCACGGATGGGACCCACGATCCACGTTGGAAGCGGCGCTACCCGTCGGGAGCACGCGCCGACGTGATCGCGAGCCAAGACGATGGCGATTCCACA
TGCAAAGTCAATATCGACGCGCAAGGGAGCAGGTAAATGAGCGGCTCCGGGAAGCGATCCAGTCGCGAGCCGACGAGCACAACCAGAACGTCCGATCCCA
GGAGATTGAGGCTGGTGCACAAGTCTGGCTGTATCTGGACCGGGTGAAGGAAGGCTACGCGAGAAAACTGGCGCATATGTGGCACGGCCCGTTCCGGGTA
GTCGAGATGGTAGGTAATCACGCAGCGAGACTGGAGACTGCTGGCACGGAGTACCGCTTATTCCGATCGTCCACGTGTCCAAGCTCAAGCTGGTGCGAAG
TTTTCCCGATCGCCCTACGTTGGCACTTACCGTGGTTGAAGGCGATCGTTTCGATTTTGACGAAGCAATCCTGCCAGAAGATAGTTGGGAACGCAGCCTT
GGCGAAGACGAATACGAGGTTGACAGATTGTGGATGTGCGATCAGGGCGGCGTACGCGCTATGGGCGAGTTCATCGAGAGTTCCAAGTGTACTGGAAGGG
CTACGAAGATCCATCATGGGTCGACGAGGCCGACCTCAACTGCGGAGCATTGTTGCGTGAGTATGAACGTGAGGTAACTAACCGCAACCGATTCGGAGTC
ATGCAGTCGCATGAGGCGGAGGAGGAGGGCTCGT
	
	
ATGATCGAGCCGAAGACGCCGCCGATCACCGAGTCGGAGATACCAGATGACGACGAAGTCTGTTACCATGAAGGAGGCGACTTGTTCGCGGAAGACGTGG
AAAAGCAGATGGCTGTCTTGCCTGAGGTAGCAACCACTACCGACGAAGTCATGATCGAAGACATTCAGGTGGGAGACCCTGATTTCAACACCCCTGAGGA
GGTCGATCGTCTACGACAAATCATCTGGCGCCGGCGTCACCTACTGATCGGAAAGGGAAACGCGTTACCCCCGGCGGCTGTAGGCGCGGTGTGCGACATC
GACGTTGGGGGAGCAACTCCTGTCGCCCAACGCGTTCGCCGGGTCGCCCCACAGTTTCGCGAGAAGCTGTCGGACCTGATCAAGAGTTTGCTGTCTGCGG
AGATGATCGTTCCGTCAACCTCGCCGTGGGCATCACCGATCGTGATCATCATCAAGAAGAACGGTGTTGACATCCGACTCTGTATCGATTACAGGCTGGT
GAACGGATTGACACGACTGATGGTATATCCCATGCCGATGATCAACGATCTCTTGGAAGATTTGGACAAGGTGCTCTGGTACTGCTCCCTCGATATGGCC
AGTGGTTTCTGGGTGGTGTCAATGACTGAGCGAGCTCGGAAGATCTCTGCCTTTGTCACGCCATTCGGACTTTTCGAGTGGACGCGCATGCCTTTTGGGC
TGAAGAACGCCCCACAGATTTATCAGAGACTGATCGACAACGCGCTGTATGGACATCTCCGAATCCGCGCCGGTCACGACCCGTCGAAGCCGATCGACGT
GTTCGAGGCAGGGGAACCAGAGCCGGAACTGAAGCCGTCCGTGCTGGGAAGATGGTCGTACATCGACGACATTCTCGTTACGGCGACCACTAGGGATACT
TTATGTGAAAAGGTTGAGAGGTTGTTGGACGCTTGCGAACGGTGGAATCTGTCGATCAGCGTTGTCAAGAGCTTCTGGGGCCAGCGCAAGGTGGGTTACT
TGGGCCATCAGGTGTCTGCTGATGGTTTGGAAGCTCACCCGAAAGACTTTGAGGCGCTGAGTAATCTCCCCTTCCCGCTGACGCTGCGATCGATGCAGGC
TTTTCTCGGAAGTTTGAACTACTACAGTCGCTTCATTGAAGACTTCGTGATCTATGCCGCCGGCTTGTACGAGCTGCGCGAAGCGGACTTTCATGAGATC
AGCCGCCTAGAGAGGATCAACCCTGACCAACAAATGACTGGGGGCGACGAACCACAGATTCCGGACGCTGATCGCTGGACCCGAGCGAAGATTGCATTCA
CAATGTTGAAGGCCAAAATCGTGTCCACACCGATCCTGAAGCATTTCGATCCCGATCGCACTCCAGTGATCGTGGTCTACGCGAGTCAGTGGGCGATATC
TGCGGCACTTGTGCAAGAGCATGATGGCGTGTACTGGCCACTCCCCGAGTGGACGATTTTGTTAGCCGCGTCGGAGTACATGCCCGATCTGACCGTGAAC
GAAGCTGAGTACCGCGGGTTGTTGCTGTGTTATGATCTGCTGTCGACTTTGGACCGGGGGCGGATCGTGATCTGCGGTGATTCCAACCTGGTGATCCGCC
AGATGCGTGGTGAGATCGCGTCGACGTACCCGTTCCAGATTGTCGCGATGGATCACATTCCGTCGTTGCCCAAGTCCTTCAAGGGCAACACGGAGCTACT
GATCTGGGTAGACCTGTTCTCGGGATATGTGATCGCGAAAGCAAGCGCGTCAAGGACGGCCCAGACGATCGCGGAGAATTATGAAGAGTGTGTATTCCGC
TAGTTCCAAGTGTACTGGAAGGGCTACGAAGATCCATCATGGGTCGACGAGGCCGACCTCAACTGCGGAGCATTGTTGCGTGAGTATGAACGTGAGGTAA
CTAACCGCAACCGATTCGGAGTCATGCAGTCGCATGAGGCGGAGGAGGAGGGCTCGTA
	
	
MIEPKTPPITESEIPDDDEVCYHEGGDLFAEDVEKQMAVLPEVATTTDEVMIEDIQVGDPDFNTPEEVDRLRQIIWRRRHLLIGKGNALPPAAVGAVCDI
DVGGATPVAQRVRRVAPQFREKLSDLIKSLLSAEMIVPSTSPWASPIVIIIKKNGVDIRLCIDYRLVNGLTRLMVYPMPMINDLLEDLDKVLWYCSLDMA
SGFWVVSMTERARKISAFVTPFGLFEWTRMPFGLKNAPQIYQRLIDNALYGHLRIRAGHDPSKPIDVFEAGEPEPELKPSVLGRWSYIDDILVTATTRDT
LCEKVERLLDACERWNLSISVVKSFWGQRKVGYLGHQVSADGLEAHPKDFEALSNLPFPLTLRSMQAFLGSLNYYSRFIEDFVIYAAGLYELREADFHEI
SRLERINPDQQMTGGDEPQIPDADRWTRAKIAFTMLKAKIVSTPILKHFDPDRTPVIVVYASQWAISAALVQEHDGVYWPLPEWTILLAASEYMPDLTVN
EAEYRGLLLCYDLLSTLDRGRIVICGDSNLVIRQMRGEIASTYPFQIVAMDHIPSLPKSFKGNTELLIWVDLFSGYVIAKASASRTAQTIAENYEECVFR
_FQVYWKGYEDPSWVDEADLNCGALLREYEREVTNRNRFGVMQSHEAEEEGS