Scaffold : scaffold_2
Gene_id : Phyra_g993
Description : hypothetical protein
TGGACGACAACGAGGACACGGACCTGCTGCTGTGGCTGCTCCAGGGCTTCATGAACTACGAAAACGACTTGAGCAAGGTGCGAAGGGAAGTGCATAGCTT
GCTGCTGGACGAGGCGTGGCGAATCGCCATGCGTAGCCGCCACTATCTGACCGCGGACTGCTTGGACACACCGTGCGACTCTGCGTGGATGTCGCTCTAC
TTGTACGGGAGCGACAAGAACTTCTTGAACGTGACCAGCCTGACAAGGTGAGCGTGAGGTCTCCGCGTATGCTGCACGTCTGTGGTCAAGGTGTTCTAAC
CTTACGCTCTGGCTTCTGTAGGGCCGCGTTTCACCAGCTGCTTGCTCGTTTCGCCGGGTTCTACGCTATCCGCCCCGCGAGGTCAAGAGGGCGGCCGCCC
AAGCTCCGTTACTTGCACCAGGTTCTTGGACTTTTGCTGTGCTTCTACACGGGGTCCACGGAGAACGGGACGTTGTGTATGATCTTCGGCGCCCCGCCCA
ACACCTTGTCAAGGACTCTGAAAAAGACAGAGGAGGCGATCGCGCTGGCACTGCACGGATACGCTCCGGCACGCATCGCGTTCCCGTCGCCGTCGGCACA
GCGAAAGCTGGCCAGGCTAGTTGAGGCACGAGAGCCGCTGCTGCAGCACAATTTCGGGTTCATCGATGGAAAAAATCTACGGGTGAGGCCTTAAATGTCT
GTGTATTAACTTCATGTCAAATGCTAACACTAGAATACGGCGCAGGTAATGCAGCCGTCCAGCGCGGATCTCCAGAATGCCATGTACAACGGCTGGCTGC
ACTCGGTGTTCGTCACGGGCGCCATCTGCTTCGCGGCGGACGGCTGCATCATCTGGTGCAAACACAACTGCCCGGGGTCGTGGAACGACTCCGACACCTC
CCTCGGGTTCCGAATGAAGATGCTCGACCCGGCTATCTGCCCGGATGCTCGAATGAACGTAGTCTCGGATTCTGCGTTCCCCTGTTCGACGGCCATGACG
GGATGTAGCGGGGCTACATATTCGGTTCACCTCCTACCTTAGTGCAACATGCACTAAGGGATACATTCAGGTGACCACCCCACAGGGTGGTCCACATTCA
TAGCAAAAGGCATATGACTGGTAGAAAGTAACACCTTTCTACTAATGAGAGTCATTTAATAGATAGGGGTTCTGCCAGCCATCCAATGGCAGAACCTCTC
ATTAGAAATATCAGTTTTAGGAGGAAACCCCATTTACAATCAATACAGTTCTCATTTGGCACCAAAGCTATCGTTCGGTTCCTTTATCTAGGTTTAAGTA
TACTTGCGGATACAAGTATACTGAACTTAAGTAAATTACTCCTACGCTTCCTCATACACGTGCGCACACGTGTAAGCTTAAGTAGTGGGTCTAAGCAGAC
CCATTACACCTGGTAGCACTTTGTAGTCCGTCCAACGACCGACTAACACGTTCGTATGGAATACGAACGCGGGGCTGAGAACCTGCCCTTGGACAGTAAC
ATGTCCGTGGGTAGCCCAAACACGTCTGCAACGCATGTTGCGCGTGCAGACTGCCCCCACCTGTCGGAACCAGAGTGGGAGGCCCTCCAACGACTGTCAA
CAGTCATTGGGGAAGCGGCGGTAGCAACGATGTTGCGAACGCTATCACCGACGGAGCAACACGGTGTTGCTCTGGGTTTCATCGTGAAGGAACAGCGTGA
AACCACTGCTCGAACTTCGGTGTCGCCATCGGCCACACCGCGCGTGGAGTCATTGAAACTCCACGTAAGCAGTTACGTAGGAAGAGAGGGCGAACCTCTC
CTCCGTTGGCTTGTCGAGGTCGACACTGCCATTGCGACTCGACGTATCGTCGACCCGTTGTCGAAGGTTGTGTTCGCCATGTCATGTCTTGGCGGACGAG
CAAGGAGTTGGGCGTACGGACGCCGACTCACAGACCCTACGTGCTTTAGCACGTACGAAGAGTTCAAGGAGGAGCTCAAACTAGCGTTTGAGCCCCCGCA
AAACGAGTTCCGATCGAGGGCGGAGTTCCTCGATCTGCAACAGGGCAAGTATGACGTGCGTGCTTACGCCCAAAGAGCACGGTACTTGGTCTCGAACATC
GTGACCAACCCGATCGACGAGGCGACAAAGGTCGTCACGTTCATGAAGGGCCTTAGAGATGGGCCTGTGAAGACCTATCTCTTCCGAGAGTATCCAAATA
CTCTCGAGGCTGCAATTGCGCTCGCAATGCAAGAAGAGTTTAGCCTGCGGCAGGCTAAACTGCATGTGAACGCCCCGCGGCTGATGCCACGACCGGTGGT
AAGGCCGTCGGGAGGTCCCGAACCAATGGACCTCTCGAGTGCGACAGCTGCTGGTTCCCAGCAGCGTCGTGGATCAACGAATGTGCGTTGTTTCCGCTGC
GGAAACATCGGTCACTATGCCCGCGAGTGCACAGCACCTGTGCACGCGGCGAGGAGCCGTCGTGGCGATACTGGGTATCGTCACGGGCAATCAAAAAACT
AGAGGGACCAGCAGGCGCGGGGCGCCCTGCTGGTGATGCGGTCGAGCGTGTCGACATCGGACACGCTGCAATGAAGATCGCTGCCCCCAGTGAGAGTCAA
TCTCACTGCAAGAAGCAAGATGACAAGCCGAACCTTGTCATCCTGAAGGTAAGCTCGAAGAGAGAGAAGTCTCTTCGTGCTCTAGTGGACTGTGGTGCGT
CGAACAACTTTGTTCGACTGCAGAGCCTTCCAAGGCTTGACTTCGAGGAAGTGAAAACACCTCGAAGTCTATTGGAAGTGAGGCTAGCAACGGGTGTCGT
TGTTAGAACCGAGAAGCGTATCGTACGCGTACGCTTCTCGTATCAAGAGAAGGAGTTCGTCGACGAGCTTATCGTCCTTGAACTGGACGATAAGTTCGAT
ATGGTGTTGGGCATGCCGTGGCTTGCACGGCATGATCCGGTGATCGACTGGACGAAGCGCACGATCGTGCGCTTCGGGAGCAGCAGCAGCGCGACAGAGA
GCGATGGCCCTGTCGGCGCAGCACATGCACCACGTGGTGCATGCGGCCCTCCACTAGAGACAGCGCGGAATGCGGCTGTCTCCGATCACCCCAAACGAAC
GCCAACGACTGCGAGAGTCGTTGGGAGAAGATGTGAACCGAATCAGCAGGGCCTGATTCAATCGGATTCGAGAGGGTCTCGAAGCGTCCGGGGCGACGCG
GTCGTGTCGACAGGTAATGTCGACACACAATTTGTCGAAAGACACTCCGCCGTTAGGCGTTCAGGTAAAGAAGGCGCGTCGGCTCTGGGAGCCGACGCTG
CAAGCAGTGCGGACGGTTGCAAACGTCCCGCACCGGAAATGCTTGCGAGCTCGCGTGCAGCCGGACTGCACGACGAAGAGGTGCGCGATCAAGCCGGGCT
TGAACGCGTGCGCCCGCGGGTAAAACCCGCCGGTGAATACAAGGAACAACTGTCCACGGCCGGGCCTGGACAAGAAGAAACTCGCGGAGCCGGGTTCCGC
ACGAGAAGTGAACGGCGCAAGCGAGCAAAGCTGCGCAAGTCTCGGTCAGGGACTGAGACGCTACAAGCAGTGTCTGCCGGGCAGACACAGGAGTTGGAGA
CGCCCGTCGAGACACTGAGTGTCTTGACGCGTACGAGTATTGGTCTCCAATACAAGAAGATGAGCAAGGCAAGGCAATCGACGACTTCTTTGAAAGTCGT
CGCAAGGCAGGACAAGTGCGGGAATCGAAGTCCCCGCACAGCGCGCCTACGTTCTGTGTGAAGAAACCACAGGGCGGGTGGCGCATCGTTCATGCGTATA
ACAAGCTGAACGATGCGACGGTACCGGCGCAGACGCCGATACCTCGAAAAGATGTGATCATCGATTCGATGACCTCGAGTACTATCTTCAGTACTCTCGA
TCTGAGAGACGGGTTCTATCAGATCCTCATGCGTGAGAGCGATATCCCTCTCACAGCGGTAAGCACTCCGAGCGGCATGCTCTGGGAGTGGCTCGTAATG
CCGCAGGGGCTGAAGAAAGAAGCTGCATGGGAATGGACTGCTGATTGTCAGCAGGCCTTTGAAGCAGTCAAGCAAGGCTTGACTGAGGCGCCGATCTTGG
CGGTGGCCGACCAAGATCGCCCACTCCACGTTGTGTGTGATGCATCCGATTTCGCGATCGGATGCGCACTGATGCAACTCGATCACGAAGGTCGCGATCG
TGTGGTCTACTACCAATCGCGTCAGCTGAAGCCAGCTGAGCGCAATTACCCGGTACATGACAAGGAACTCCTTGCCATGAAGTATGCACTCGCAAAGTTT
CGAGTGTATCTACTTGGGAGTAGACCATTCGTGGTCTACACCGACCACGCATCGTTGCGTACGGCGATCAAGTCGCCGCACATATCACAAAGAATGGCAC
GGTGGCTGTCATTCTTTGCTGAATACAACTTCCAGGTTGAGTACAAACCTGGAAGGTTGAATGTCGTGGCCGACGCGCTTTCGCGTCGACCAGATTATGC
GGTGCAAGAGGCCGACGACTACACCCTCGTCGTCCTTGCTGGACGACGTGAAGGCCGCATACGCACATGATGCGGATGCGAAGCAATTGTTGGAGTACTT
CTCCACACCTTCTGACAAGTCTCGTCAGAAGCTGGCCAAACACCTTCGTGCCCGTGTACACCGTTATCGTGTACACAATGGTCTGCTGCTTTACAGCGCA
GTCGACGACAACGCAGATCGCATTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTACGAGTACCACGATGCCCCGACATCGGGACATCCTG
GCCGTGAGAAGACATATTTGCTTCTCACGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAAGTACGTTCGTGCTTGCGAGGTATGCCAGCG
CGTGAAGCCTGCGCCCAACTCGCAGGCTCCGCTTCAATCACTACCGACTCCGTCGGAGTGCTGGCAGTCCATTTCAATGGACTTTGTTTTTGGTCTTCCG
CAAGACAACAAGCGGAGGACTGGTATTGTGGTCTTTGTTGACCGCTTCAGCAAGATGGTGCATCTTGCTGCAGTACCAGCCGAGGTGACAGCCAAACAGA
CGGCATGTCTGTTTGTCGACATGGTGTTTAGACACCATGGTATGCCACTCGACATCGTGTCGGATCGGGATCCGCGCTTTACAGCGCGATTCTGGCAAGA
AGTGTTTACACTTCTTGGGACGCAGTTGTCCATGTCGACTGCGGATCACCCGCAGACCGACGGACAAACAGAGCGTGTCAACCGCGTGCTGGTTGACACC
ATGAAGAGCTACGCGCACTCGTTCCATCAATGGAGCGACTGCTTGCCGATGGCGGAGTTCGCCATCAACAACTCGGTGCATGTCTCGACAGGACACACAC
CGTTCTACGTGAATGCCATGAGGCACCCACGCGTACCGAGCGTACTCGGTGCGGTAGCTCCTTCCTTAAGTGGGGGAGGATATCCGGTTAATTCAAAACA
ACCGGATAAGCACGCTGATACAAGCAATGTATCAGCTGTGACGACTCGCGCACGTACTGCGCGCAGTCATGGCGACGACAACACAGTGTCTACGACGGGC
GTAGACACTTTAAACGACAACGAACATCACGCGCAGGCCGGGCCTGCTGCGAACAAGGAGCACGAACTGAACCAGGGGTTCAGCTCGGATGCAATGGACT
TTGTCCAGCGTCGACAAGCCGTA
	
	
TGGACGACAACGAGGACACGGACCTGCTGCTGTGGCTGCTCCAGGGCTTCATGAACTACGAAAACGACTTGAGCAAGGTGCGAAGGGAAGTGCATAGCTT
GCTGCTGGACGAGGCGTGGCGAATCGCCATGCGTAGCCGCCACTATCTGACCGCGGACTGCTTGGACACACCGTGCGACTCTGCGTGGATGTCGCTCTAC
TTGTACGGGAGCGACAAGAACTTCTTGAACGTGACCAGCCTGACAAGGGCCGCGTTTCACCAGCTGCTTGCTCGTTTCGCCGGGTTCTACGCTATCCGCC
CCGCGAGGTCAAGAGGGCGGCCGCCCAAGCTCCGTTACTTGCACCAGGTTCTTGGACTTTTGCTGTGCTTCTACACGGGGTCCACGGAGAACGGGACGTT
GTGTATGATCTTCGGCGCCCCGCCCAACACCTTGTCAAGGACTCTGAAAAAGACAGAGGAGGCGATCGCGCTGGCACTGCACGGATACGCTCCGGCACGC
ATCGCGTTCCCGTCGCCGTCGGCACAGCGAAAGCTGGCCAGGCTAGTTGAGGCACGAGAGCCGCTGCTGCAGCACAATTTCGGGTTCATCGATGGAAAAA
ATCTACGGCCGTCCAGCGCGGATCTCCAGAATGCCATGTACAACGGCTGGCTGCACTCGGTGTTCGTCACGGGCGCCATCTGCTTCGCGGCGGACGGCTG
CATCATCTGGTGCAAACACAACTGCCCGGGGTCGTGGAACGACTCCGACACCTCCCTCGGGTTCCGAATGAAGATGCTCGACCCGGCTATCTGCCCGGAT
GCTCGAATGAACGTAGTCTCGGATTCTGCGTTCCCCTACCCTACGTGCTTTAGCACGTACGAAGAGTTCAAGGAGGAGCTCAAACTAGCGTTTGAGCCCC
CGCAAAACGAGTTCCGATCGAGGGCGGAGTTCCTCGATCTGCAACAGGGCAAGTATGACGTGCGTGCTTACGCCCAAAGAGCACGGTACTTGGTCTCGAA
CATCGTGACCAACCCGATCGACGAGGCGACAAAGGTCGTCACGTTCATGAAGGGCCTTAGAGATGGGCCTGTGAAGACCTATCTCTTCCGAGAGTATCCA
AATACTCTCGAGGCTGCAATTGCGCTCGCAATGCAAGAAGAGTTTAGCCTGCGGCAGGCTAAACTGCATGTGAACGCCCCGCGGCTGATGCCACGACCGG
TGAAGGAGTTCGTCGACGAGCTTATCGTCCTTGAACTGGACGATAAGTTCGATATGGTGTTGGGCATGCCGTGGCTTGCACGGCATGATCCGGTGATCGA
CTGGACGAAGCGCACGATCGTGCGCTTCGGGAGCAGCAGCAGCGCGACAGAGAGCGATGGCCCTGTCGGCGCAGCACATGCACCACGTGAAGATGAGCAA
GGCAAGGCAATCGACGACTTCTTTGAAAGTCGTCGCAAGGCAGGACAAGTGCGGGAATCGAAGTCCCCGCACAGCGCGCCTACGTTCTGTGTGAAGAAAC
CACAGGGCGGGTGGCGCATCGTTCATGCGTATAACAAGCTGAACGATGCGACGGTACCGGCGCAGACGCCGATACCTCGAAAAGATGTGATCATCGATTC
GATGACCTCGAGTACTATCTTCAGTACTCTCGATCTGAGAGACGGGTTCTATCAGATCCTCATGCGTGAGAGCGATATCCCTCTCACAGCGGTAAGCACT
CCGAGCGGCATGCTCTGGGAGTGGCTCGTAATGCCGCAGGGGCTGAAGAAAGAAGCTGCATGGGAATGGACTGCTGATTTCGACGACAACGCAGATCGCA
TTGTCGTGCCGGATGATCATGAGCTGAAGCTCAAGATCACGTACGAGTACCACGATGCCCCGACATCGGGACATCCTGGCCGTGAGAAGACATATTTGCT
TCTCACGCGTGACTTCTATTGGAGTCACCAGTACAAGTGGGTACGCAACGTCGACAAGCCGTAA
	
	
WTTTRTRTCCCGCSRAS_TTKTT_ARCEGKCIACCWTRRGESPCVAATI_PRTAWTHRATLRGCRSTCTGATRTS_T_PA_QGPRFTSCLLVSPGSTLSA
PRGQEGGRPSSVTCTRFLDFCCASTRGPRRTGRCV_SSAPRPTPCQGL_KRQRRRSRWHCTDTLRHASRSRRRRHSESWPG_LRHESRCCSTISGSSMEK
IYGRPARISRMPCTTAGCTRCSSRAPSASRRTAASSGANTTARGRGTTPTPPSGSE_RCSTRLSARMLE_T_SRILRSPTLRALARTKSSRRSSN_RLSP
RKTSSDRGRSSSICNRASMTCVLTPKEHGTWSRTS_PTRSTRRQRSSRS_RALEMGL_RPISSESIQILSRLQLRSQCKKSLACGRLNCM_TPRG_CHDR
_RSSSTSLSSLNWTISSIWCWACRGLHGMIR_STGRSARSCASGAAAARQRAMALSAQHMHHVKMSKARQSTTSLKVVARQDKCGNRSPRTARLRSV_RN
HRAGGASFMRITS_TMRRYRRRRRYLEKM_SSIR_PRVLSSVLSI_ETGSIRSSCVRAISLSQR_ALRAACSGSGS_CRRG_RKKLHGNGLLISTTTQIA
LSCRMIMS_SSRSRTSTTMPRHRDILAVRRHICFSRVTSIGVTSTSGYATSTSR