Scaffold : Scaffold_621
Gene_id : Phymu_g11197
Description : conserved hypothetical protein
ATGCACCTTCGGTTCCCTTTGCCGGCCGGCTACTTCGCCAAGTTCGACTTACTACCGAACGAGGCGCAGAACTACCGGTCGTTGGCCAGCGACATCGTCC
GCGAGACGAAACGGGATCTGGATCACTACGTCAAAGACGGACGCAACCTCATCGACGCGCACACGTGGAAACTCGCCAAGTCCAAGGAGCGACTGCACTG
CTACCGGAAGCGCAGCACGCAGAACTCGGCGCACCAATTGGGACTGTACGGGACCGCCGACTCGTCCGACTCGTTCGGCCAATCGACCCGTTCGAGGCCG
TCAATGAGCGTCACGAGCTCCCGTAGTCGATCGGGACACGACGATATGGGCAACTTGTCGGTGTCCACGCGGTCGtcggacgacggcgagcCCAGTCGCA
AGAGCATTCAACCGACAGTGATCGGCTACGGCATTATGGACGGATCAGTGGACGATTTGGTGTACGGGCTGTACCAGTCGTCGACCGACGAAATGAAGAC
GCTGTCAGCGTTCCTAGGGGACGATTCGCTCATCGACTGCGCTGTACTCAAGACGATTCGACAGACGCGGTCGTCGTACCTGGGACTCAAGTGGAATCTG
TCCCGCACCGTCGGCGGCAaccgcgactgctgcttcatggAGTACGTGGGGGTATCGGAGGACGCGAACGGCCAGCGCTTCGGCTATCACGTGCTGGAGT
CCGTCGTGGTCCGCAACTGTCCGCAGTTCGACGACAACTCGATCGTCCGTACCAACATGTCGTTCTGCTTTATCTTCCGACCGGGGAAGCTGGCGGACCA
GGTGGAAGTGTTCATGGAAGGCGCGTTCGATTCGTCCGCGGATGTACTCACTGCTGGCGGTGTGGGAGACTACAGAAGCTCCATGGACATGCTGTTTAAC
CTTCCTACAGCTCTCGTAGGCGCTGAAGCCAAGAAAATCTCAGCTATGGTCAACAAACAGTCCGGGGCGCTGCGGGGCGCGAGCGGCAAGAACCAGAGCG
GGAATCACTGCTCCATCTGCCGTGCCAAGTCCGGCTTGTTGTCGTCCCATACGAATTGCCAGACGTGCGGCGCCGTCATTTGCAGTAAATGCCGTATCCG
GAAAGTGACGTTCTCGCGTCGAGGGAAGATCAAGGTCTCGTGCTGTAAGATGTGCATGGTCATGGTCAAGGACCAGTCGCCGTTCGCAGgggaacagctc
gagcagcagcccgtgaagaccaagaagaagatctcAAGACACGACAGTCGCAGTaggaacaacagcagcaacgctaGGATGGACACGATCAACGCGTCCG
TGTCGACGATGTCCCTCACGGACTCGgagttctcgtcctcgtaccAGTCGTGGCAGTCGAGTTCCGTGTCTTCGCTTCAGTCCGACCTCGACGACAGTTT
CTACAACTCTAATGGTCCGGGGAACGCGATGGTTCCACTTGAGCGGAAGATGCCGGCTCTGATGGAGGGTGGACCGCCTGCTACGACGTaccagagcgag
cagcaacggcagtacgagcagcaacagttcCAACAGCACCAGTTCCTCGTGCGGCAGCAAATGAAGCAGAACGTGGACCCGAATATCCTCCCGATGCCGA
GCCACCGCCAGCCAACGACGCGCGAAGGGCTGTACAAtcagatgctggagctgcagatgcaggccGAGCGGGCGTACAACTTGACCAACCAGAACGCCAA
CATGATGAACTCGGGCCGATA
	
	
ATGCACCTTCGGTTCCCTTTGCCGGCCGGCTACTTCGCCAAGTTCGACTTACTACCGAACGAGGCGCAGAACTACCGGTCGTTGGCCAGCGACATCGTCC
GCGAGACGAAACGGGATCTGGATCACTACGTCAAAGACGGACGCAACCTCATCGACGCGCACACGTGGAAACTCGCCAAGTCCAAGGAGCGACTGCACTG
CTACCGGAAGCGCAGCACGCAGAACTCGGCGCACCAATTGGGACTGTACGGGACCGCCGACTCGTCCGACTCGTTCGGCCAATCGACCCGTTCGAGGCCG
TCAATGAGCGTCACGAGCTCCCGTAGTCGATCGGGACACGACGATATGGGCAACTTGTCGGTGTCCACGCGGTCGtcggacgacggcgagcCCAGTCGCA
AGAGCATTCAACCGACAGTGATCGGCTACGGCATTATGGACGGATCAGTGGACGATTTGGTGTACGGGCTGTACCAGTCGTCGACCGACGAAATGAAGAC
GCTGTCAGCGTTCCTAGGGGACGATTCGCTCATCGACTGCGCTGTACTCAAGACGATTCGACAGACGCGGTCGTCGTACCTGGGACTCAAGTGGAATCTG
TCCCGCACCGTCGGCGGCAaccgcgactgctgcttcatggAGTACGTGGGGGTATCGGAGGACGCGAACGGCCAGCGCTTCGGCTATCACGTGCTGGAGT
CCGTCGTGGTCCGCAACTGTCCGCAGTTCGACGACAACTCGATCGTCCGTACCAACATGTCGTTCTGCTTTATCTTCCGACCGGGGAAGCTGGCGGACCA
GGTGGAAGTGTTCATGGAAGGCGCGTTCGATTCGTCCGCGGATGTACTCACTGCTGGCGGTGTGGGAGACTACAGAAGCTCCATGGACATGCTGTTTAAC
CTTCCTACAGCTCTCGTAGGCGCTGAAGCCAAGAAAATCTCAGCTATGGTCAACAAACAGTCCGGGGCGCTGCGGGGCGCGAGCGGCAAGAACCAGAGCG
GGAATCACTGCTCCATCTGCCGTGCCAAGTCCGGCTTGTTGTCGTCCCATACGAATTGCCAGACGTGCGGCGCCGTCATTTGCAGTAAATGCCGTATCCG
GAAAGTGACGTTCTCGCGTCGAGGGAAGATCAAGGTCTCGTGCTGTAAGATGTGCATGGTCATGGTCAAGGACCAGTCGCCGTTCGCAGgggaacagctc
gagcagcagcccgtgaagaccaagaagaagatctcAAGACACGACAGTCGCAGTaggaacaacagcagcaacgctaGGATGGACACGATCAACGCGTCCG
TGTCGACGATGTCCCTCACGGACTCGgagttctcgtcctcgtaccAGTCGTGGCAGTCGAGTTCCGTGTCTTCGCTTCAGTCCGACCTCGACGACAGTTT
CTACAACTCTAATGGTCCGGGGAACGCGATGGTTCCACTTGAGCGGAAGATGCCGGCTCTGATGGAGGGTGGACCGCCTGCTACGACGTaccagagcgag
cagcaacggcagtacgagcagcaacagttcCAACAGCACCAGTTCCTCGTGCGGCAGCAAATGAAGCAGAACGTGGACCCGAATATCCTCCCGATGCCGA
GCCACCGCCAGCCAACGACGCGCGAAGGGCTGTACAAtcagatgctggagctgcagatgcaggccGAGCGGGCGTACAACTTGACCAACCAGAACGCCAA
CATGATGAACTCGGGCCGATAG
	
	
MHLRFPLPAGYFAKFDLLPNEAQNYRSLASDIVRETKRDLDHYVKDGRNLIDAHTWKLAKSKERLHCYRKRSTQNSAHQLGLYGTADSSDSFGQSTRSRP
SMSVTSSRSRSGHDDMGNLSVSTRSSDDGEPSRKSIQPTVIGYGIMDGSVDDLVYGLYQSSTDEMKTLSAFLGDDSLIDCAVLKTIRQTRSSYLGLKWNL
SRTVGGNRDCCFMEYVGVSEDANGQRFGYHVLESVVVRNCPQFDDNSIVRTNMSFCFIFRPGKLADQVEVFMEGAFDSSADVLTAGGVGDYRSSMDMLFN
LPTALVGAEAKKISAMVNKQSGALRGASGKNQSGNHCSICRAKSGLLSSHTNCQTCGAVICSKCRIRKVTFSRRGKIKVSCCKMCMVMVKDQSPFAGEQL
EQQPVKTKKKISRHDSRSRNNSSNARMDTINASVSTMSLTDSEFSSSYQSWQSSSVSSLQSDLDDSFYNSNGPGNAMVPLERKMPALMEGGPPATTYQSE
QQRQYEQQQFQQHQFLVRQQMKQNVDPNILPMPSHRQPTTREGLYNQMLELQMQAERAYNLTNQNANMMNSGR_