Scaffold : Scaffold_1
Gene_id : Physo_538417
Description : Hypothetical protein
ATGATGAGGACGCTGCTGGGCGCCGCGCTGTGCGGCCTGGCGGCCGCGACGTCGGCCGTGTCGGCCTCCACCCTGTTCCCCCACGTGCCGGTCTTCCTGT
GGTCCCAGAGCTCGTACGTTTTATCCTCCTTCGCCCTGCTGCATTTGCCTGCCTCGAGCCGTGGATCTTACAGAGCTTCGCTCTTTGTTGCGCAGCATCT
TCGCTGGACCCAACGCCTACCTGAGCTCCGAGATGGATGAGTCCGCTGTGGCATCGGCTGTCGAGCGCGTGCTGACGCGAGATGCTAGCGCTGACAAGGA
GGTGCGTTTGCGTCTTGGCAACAGCATTCCCCTCTGTCCCCTCACTGATAACGCTCGTGTTGCTCCTCTCAGGGCGTGCTCAGCACCGAGCTCTCTTCGT
CCCAGCAGTCCGAGGTGATGTGTTTGTTCCTGCTGCCGTCGCTTACGTCGGAGGATGTGTCCCAACTCGCGAGATCCGCAGGACAGGAGTCCTTCGTGCA
GAACGCCGTGCAGAGCTCCAAGTCGTCGGTAGTGATCCCTCACACCACCCGCACCAAGCCTCTCCTCCCCGAGATGGCGAGTGCCCAGCCCCACATCGTG
GCCTCTCAAGACCTGGATGTGTTTATTGCGTCTAGGGAGGGCAAGGCGCTGCTCTCCAACGGCAAGACGGAGCTGCTGGTCGTGCAGCTCCCGGAGACCC
TGCCGCTGCCCGACGTGGATGCCGCGATCCAGGCGGCTTCAAGCAGCCTCAACGCCGCCACCGGGGGTAAGACAGACTTTGGTCTTACTGGTAACGACGC
CAGCTCGCTGGACCTCCAGGACCCGCTGGCTCGTCGCCTTGCCGCGCAGACCAAGTCGAAGAAGTCGAACTCGTCTGCTGAGGCTGCGATTCTGTGCGAA
GCGGGCTACCTCGTCGGGTACAGTGCGGCGGGCAAGGCCTTCTGCTTCTCGCACTACGTGAACATCACGCCCGACATCATGGCGGGCCTCCTCTTCGGGC
TGCTGTTCATTTTTATGGCGTACATCGGTCTGGGCGTGCTCCACCAGATCCAGACGCCGCAGAGGTACCCGTCGCACGGAGCTCCGCGCGGCAAGGAGTT
CTAGGCGCGTTGGCTGTGGACTTGAAAGTGAGCAGCATAGCCAGCAGAAGCGAAGGCAGGATGCATGCAAAATGAAAGTTTTATATTCCC
	
	
ATGATGAGGACGCTGCTGGGCGCCGCGCTGTGCGGCCTGGCGGCCGCGACGTCGGCCGTGTCGGCCTCCACCCTGTTCCCCCACGTGCCGGTCTTCCTGT
GGTCCCAGAGCTCCATCTTCGCTGGACCCAACGCCTACCTGAGCTCCGAGATGGATGAGTCCGCTGTGGCATCGGCTGTCGAGCGCGTGCTGACGCGAGA
TGCTAGCGCTGACAAGGAGGGCGTGCTCAGCACCGAGCTCTCTTCGTCCCAGCAGTCCGAGGTGATGTGTTTGTTCCTGCTGCCGTCGCTTACGTCGGAG
GATGTGTCCCAACTCGCGAGATCCGCAGGACAGGAGTCCTTCGTGCAGAACGCCGTGCAGAGCTCCAAGTCGTCGGTAGTGATCCCTCACACCACCCGCA
CCAAGCCTCTCCTCCCCGAGATGGCGAGTGCCCAGCCCCACATCGTGGCCTCTCAAGACCTGGATGTGTTTATTGCGTCTAGGGAGGGCAAGGCGCTGCT
CTCCAACGGCAAGACGGAGCTGCTGGTCGTGCAGCTCCCGGAGACCCTGCCGCTGCCCGACGTGGATGCCGCGATCCAGGCGGCTTCAAGCAGCCTCAAC
GCCGCCACCGGGGGTAAGACAGACTTTGGTCTTACTGGTAACGACGCCAGCTCGCTGGACCTCCAGGACCCGCTGGCTCGTCGCCTTGCCGCGCAGACCA
AGTCGAAGAAGTCGAACTCGTCTGCTGAGGCTGCGATTCTGTGCGAAGCGGGCTACCTCGTCGGGTACAGTGCGGCGGGCAAGGCCTTCTGCTTCTCGCA
CTACGTGAACATCACGCCCGACATCATGGCGGGCCTCCTCTTCGGGCTGCTGTTCATTTTTATGGCGTACATCGGTCTGGGCGTGCTCCACCAGATCCAG
ACGCCGCAGAGGTACCCGTCGCACGGAGCTCCGCGCGGCAAGGAGTTCTAGGCGCGTTGGCTGTGGACTTGAAAGTGAGCAGCATAGCCAGCAGAAGCGA
AGGCAGGATGCATGCAAAATGAAAGTTTTATATTCCCC
	
	
MMRTLLGAALCGLAAATSAVSASTLFPHVPVFLWSQSSIFAGPNAYLSSEMDESAVASAVERVLTRDASADKEGVLSTELSSSQQSEVMCLFLLPSLTSE
DVSQLARSAGQESFVQNAVQSSKSSVVIPHTTRTKPLLPEMASAQPHIVASQDLDVFIASREGKALLSNGKTELLVVQLPETLPLPDVDAAIQAASSSLN
AATGGKTDFGLTGNDASSLDLQDPLARRLAAQTKSKKSNSSAEAAILCEAGYLVGYSAAGKAFCFSHYVNITPDIMAGLLFGLLFIFMAYIGLGVLHQIQ
TPQRYPSHGAPRGKEF_ARWLWT_K_AA_PAEAKAGCMQNESFIFP