Scaffold : Scaffold_1
Gene_id : Physo_127047
Description : hypothetical protein
ATGCAGCTCATAAGAGAAGGAATCATTGAGCATTGTGGCTACGTCTTCCAGCTCATATGCCTCGACAACAACGACGGTGTCCGCTTCGGCACGTTCCAGC
CTGTTATGGTGTCTGTGACTACCGCTTTAGAAGCGCAACTGGAAGCAACTACCCCCTCAGCCCAATCCAGTGCAGGCTGTGCTTGAAGCTGACGATATCC
AGCACCACCACCACGAAAGCCGACGCGAAGATGAAAACGAGGATGACGAAGATGAAGACGAAGATGAGGACGAGTATGACGAAGACGAAGACGAAGAGGA
ATACTGGGACGAAGACGATTTTTCCGGCGGCGAGCGCGTCACGGCATCCGAACGTAAGCGCCTGCGTGCAATCCATCGAAAAAATGAGCGGCTCGAGCAT
TTGCGAGCTCTAGAACGGGTGAAGAGTCTTCGAAAAGCAGCAACGGATGCCAGCCTGCAACCGATCGACACGGACAATATTGAAGAGCTTACGACATTGC
TGAACAGCATGGAAGACGGATTTGGTACGCGGTTTTTTGCCAGCCAAGAGAAGCAGAGGCGTCGTGCCGTTGGAATCGTGGAGGAGCATTGGAAGAGGAT
TGAAGTAAACTTAGACACCGACACAACTACGCAAAACCAATCCACTGCTTCGCCAGCACTGTGAAGCCGTTTTCCAGCCGCTCAAGAAGTTCATGATTCG
ACATCTGAAGCATGTGCGGTACGTTCGTCCGCCGCGCTATTGGCGTGATGGATG
	
	
ATGCAGCTCATAAGAGAAGGAATCATTGAGCATTGTGGCTACGTCTTCCAGCTCATATGCCTCGACAACAACGACGGTGTCCGCTTCGGCACGTTCCAGC
CTGTTATGAAGCGCAACTGGAAGCAACTACCCCCTCAGCCCAATCCAGTGCAGGCTGTGCTTGAAGCTGACGATATCCAGCACCACCACCACGAAAGCCG
ACGCGAAGATGAAAACGAGGATGACGAAGATGAAGACGAAGATGAGGACGAGTATGACGAAGACGAAGACGAAGAGGAATACTGGGACGAAGACGATTTT
TCCGGCGGCGAGCGCGTCACGGCATCCGAACCATGGAAGACGGATTTGCCGCTCAAGAAGTTCATGATTCGACATCTGAAGCATGTGCGGTACGTTCGTC
CGCCGCGCTATTGGCGTGATGGATGA
	
	
MQLIREGIIEHCGYVFQLICLDNNDGVRFGTFQPVMKRNWKQLPPQPNPVQAVLEADDIQHHHHESRREDENEDDEDEDEDEDEYDEDEDEEEYWDEDDF
SGGERVTASEPWKTDLPLKKFMIRHLKHVRYVRPPRYWRDG_