Scaffold : Scaffold_1
Gene_id : Phymu_g40
Description : conserved hypothetical protein
ATGGCGGACATCTCGCACTATGGacctgcagctggagacgcggCGTCTTCACCGCTGTTCCGTGCATTAAGCGTGCGTTCAGGCAATGTGGTTGTGCTGG
GGATGCAGCGCTTTGCTTCGGTCAATTGCGCAGGTATGGCGCTCTTCCGGGTCTTCCAGGGGAACGTAGAGGTATTGGGATTCCGACCTCCTCTAGGCGT
GTATTTCTCCTTGCATTCGCCCAAATGGAGCAGTTTGGTGGTAATTGAAGGCCGATCAGGGAACGAAGACACCCAGTCGCCTTTCGGACCTACGAACGCC
AGTCTGTTGCAAGCTATGGAGCCGAATTTACCAGCGGAAGCCGtgaatgaggacgaggagatcgctGCCGACAAACTGGCCATGCAACTCGTGGGCAATT
TCCCCATTGTATTGGTGCTACGTGCCATCCCTGTGACGTACGGGAACATTATGAGTTTCTATGAAAATACACGACCAGAGAAGCTGTCGGCCGTTCTTCC
AGGTTTCAAGATGATCATCTCAAAGCACAACCAGAGCGTTTTGAGTGCGCTTACAGCTGGCTTCGACTGCACAAGTGCCGCTCCGTTAGATACAGATCCA
TCCCATCATGACTGGAAGACTCCGGAACGAGTTCTCGCTGAGCTAGTGGTCGTGGATTCCTTCAAGACGTTGAGTTTTACTGAGCATTGGCAAGCGACAG
CCGACAGACTGCAGTTGAGTCTACTGGAGAACGCGACGCCGCAGAAGATCGTCGTGTGCGGAGGCAAAGGCGTGGGCAAGTCGACGTTCTGCAGGTTTCT
AGTGAATCGGTTGCTGGCCAAGTTCGGCACTGTGGCTTTCCTGGATACAGATTTAGGGCAGAGTGAGCTCACGCCGTCCGGACTGGTGGCGCTCCATGCG
TTGACGACGCCGCTGCTCGGTCCGGGTTTCTCACACATGAAGAACCCGATCCGGTCGTTCTTCTGCGGCAACGCAAACCCTGGCAACGACCCGCTGTACT
ACATGAAGGCAGTCAAGAGTCTGCTTCGCCTGTACCAAGTCAAATGGGGGACTCAAGACTCGAACGTACCGCTGGTGATCAACACCGACGGGTGGATCAA
GAGCATGGGCCACGACCTGCTGTGCAACGTCATACAGGAAACGAACCCCGAtcacgtcgtgcagctggtGGCCGCCACCAAGAACAAACAGTTCGACGTC
CCCACGGAAGGCAAATGGCGTCTCCACGCCGTGCCGCCTTGGGATCCCGTGGGCGTGACGCAGCCTCCTCGAAGCTCCAAGGAGCTGCGGACCTACCGCT
TCCACTCGTACTTCCTGTCTCGCTCTCGTTGCGTTCTCCCGCGGGCCCAGCTCCAGAATCTCCAAGTCCTGTCGGAAAAGAACCGTCTGGACGGCGATAT
CTACCGCGCGTACGCCCAACTCACTCCTTTCGCCGTGTCCTTCGACCACGTGGACGTTGCGTTCGCCGGTGCGTCCGTGGCTCCCAGTCAGCTCCTCTTC
TCTCTCAACGCCTGCGTCGTGGGTCTCTGTATCAACCCCCAGTACAAATCGAggagtgacgacgaagctgaaggaccGCCACGGATCGTTCTGCAGCCTA
TACACGCGCCGTGTCTGGGTGTGGGAATCGTTCGAGCTGTGGACGCTGAGAGACGTCAGCTGTTCCTGTTAAGTCCGCTGCCCCTCTCAGTCTTGAAACG
AGTGAACGTACTGGTACGCAGCAGTATGCCGCTCGATAGCATTCTTTTATCTGCGCAGGAGCCTGCTCAAGCTCCGTACGTGGTCACAGACGTTGTCGCA
TCGGACGGCACGGGCTCCGCTGTCATGCAGAGTCGCAACAACCTCAAACGCAAGCGCGACGGCAAGTA
	
	
ATGGCGGACATCTCGCACTATGGacctgcagctggagacgcggCGTCTTCACCGCTGTTCCGTGCATTAAGCGTGCGTTCAGGCAATGTGGTTGTGCTGG
GGATGCAGCGCTTTGCTTCGGTCAATTGCGCAGGTATGGCGCTCTTCCGGGTCTTCCAGGGGAACGTAGAGGTATTGGGATTCCGACCTCCTCTAGGCGT
GTATTTCTCCTTGCATTCGCCCAAATGGAGCAGTTTGGTGGTAATTGAAGGCCGATCAGGGAACGAAGACACCCAGTCGCCTTTCGGACCTACGAACGCC
AGTCTGTTGCAAGCTATGGAGCCGAATTTACCAGCGGAAGCCGtgaatgaggacgaggagatcgctGCCGACAAACTGGCCATGCAACTCGTGGGCAATT
TCCCCATTGTATTGGTGCTACGTGCCATCCCTGTGACGTACGGGAACATTATGAGTTTCTATGAAAATACACGACCAGAGAAGCTGTCGGCCGTTCTTCC
AGGTTTCAAGATGATCATCTCAAAGCACAACCAGAGCGTTTTGAGTGCGCTTACAGCTGGCTTCGACTGCACAAGTGCCGCTCCGTTAGATACAGATCCA
TCCCATCATGACTGGAAGACTCCGGAACGAGTTCTCGCTGAGCTAGTGGTCGTGGATTCCTTCAAGACGTTGAGTTTTACTGAGCATTGGCAAGCGACAG
CCGACAGACTGCAGTTGAGTCTACTGGAGAACGCGACGCCGCAGAAGATCGTCGTGTGCGGAGGCAAAGGCGTGGGCAAGTCGACGTTCTGCAGGTTTCT
AGTGAATCGGTTGCTGGCCAAGTTCGGCACTGTGGCTTTCCTGGATACAGATTTAGGGCAGAGTGAGCTCACGCCGTCCGGACTGGTGGCGCTCCATGCG
TTGACGACGCCGCTGCTCGGTCCGGGTTTCTCACACATGAAGAACCCGATCCGGTCGTTCTTCTGCGGCAACGCAAACCCTGGCAACGACCCGCTGTACT
ACATGAAGGCAGTCAAGAGTCTGCTTCGCCTGTACCAAGTCAAATGGGGGACTCAAGACTCGAACGTACCGCTGGTGATCAACACCGACGGGTGGATCAA
GAGCATGGGCCACGACCTGCTGTGCAACGTCATACAGGAAACGAACCCCGAtcacgtcgtgcagctggtGGCCGCCACCAAGAACAAACAGTTCGACGTC
CCCACGGAAGGCAAATGGCGTCTCCACGCCGTGCCGCCTTGGGATCCCGTGGGCGTGACGCAGCCTCCTCGAAGCTCCAAGGAGCTGCGGACCTACCGCT
TCCACTCGTACTTCCTGTCTCGCTCTCGTTGCGTTCTCCCGCGGGCCCAGCTCCAGAATCTCCAAGTCCTGTCGGAAAAGAACCGTCTGGACGGCGATAT
CTACCGCGCGTACGCCCAACTCACTCCTTTCGCCGTGTCCTTCGACCACGTGGACGTTGCGTTCGCCGGTGCGTCCGTGGCTCCCAGTCAGCTCCTCTTC
TCTCTCAACGCCTGCGTCGTGGGTCTCTGTATCAACCCCCAGTACAAATCGAggagtgacgacgaagctgaaggaccGCCACGGATCGTTCTGCAGCCTA
TACACGCGCCGTGTCTGGGTGTGGGAATCGTTCGAGCTGTGGACGCTGAGAGACGTCAGCTGTTCCTGTTAAGTCCGCTGCCCCTCTCAGTCTTGAAACG
AGTGAACGTACTGGTACGCAGCAGTATGCCGCTCGATAGCATTCTTTTATCTGCGCAGGAGCCTGCTCAAGCTCCGTACGTGGTCACAGACGTTGTCGCA
TCGGACGGCACGGGCTCCGCTGTCATGCAGAGTCGCAACAACCTCAAACGCAAGCGCGACGGCAAGTAA
	
	
MADISHYGPAAGDAASSPLFRALSVRSGNVVVLGMQRFASVNCAGMALFRVFQGNVEVLGFRPPLGVYFSLHSPKWSSLVVIEGRSGNEDTQSPFGPTNA
SLLQAMEPNLPAEAVNEDEEIAADKLAMQLVGNFPIVLVLRAIPVTYGNIMSFYENTRPEKLSAVLPGFKMIISKHNQSVLSALTAGFDCTSAAPLDTDP
SHHDWKTPERVLAELVVVDSFKTLSFTEHWQATADRLQLSLLENATPQKIVVCGGKGVGKSTFCRFLVNRLLAKFGTVAFLDTDLGQSELTPSGLVALHA
LTTPLLGPGFSHMKNPIRSFFCGNANPGNDPLYYMKAVKSLLRLYQVKWGTQDSNVPLVINTDGWIKSMGHDLLCNVIQETNPDHVVQLVAATKNKQFDV
PTEGKWRLHAVPPWDPVGVTQPPRSSKELRTYRFHSYFLSRSRCVLPRAQLQNLQVLSEKNRLDGDIYRAYAQLTPFAVSFDHVDVAFAGASVAPSQLLF
SLNACVVGLCINPQYKSRSDDEAEGPPRIVLQPIHAPCLGVGIVRAVDAERRQLFLLSPLPLSVLKRVNVLVRSSMPLDSILLSAQEPAQAPYVVTDVVA
SDGTGSAVMQSRNNLKRKRDGK_