Scaffold : Scaffold_81
Gene_id : Phyke_g4876
Description : hypothetical protein PHYSODRAFT_320526
ATGTACCTCGAGGTCGTTGCCACACCCAACAAAGGTGTTGGTGTCCACATCAATGCGTTCGATGACGCCACGAAGGTCGCCGCACACCAACTCAAGCCCA
AGAGACTCCTGTACACGAGTGTTCTGGTCTCACTATTACAACCGTTCCAAAGCGGTTGGTCGACCTCGCAGATGAATCTGTCGCAGTACAACGATACGGC
CCAGTGTAATGCTCGTCCTGTGGCTGAAGGAACGTGCCTCATGTTCCCTGGCCACTCGAAGCTAGAGTGGACATTCGCAGTGAACGCATGGATCTTCGGT
GCTATGATCGGTTCTCTGTGCTGCGGCTACTTCAGCGACAAGCTAGGTCGCAAGAAGGTTTTGATGATCAACTGCGTCTTCATGATCGTTGGCGGCATGA
TCCAGGCGACCGTGTCCAACATTTGGCTGTTCGCCATTGGCCGCCTCATCGCCGGCTTGGCGTCGGGTACAGCCACAGGTACGATTGGTGCGTACGTGAA
CGAGCTATCGCCACCGCACATGCGCAACACGCTGGGTTTGGGTCTGCAGATTTCCACGACCATTGGCATCCTGCTCCCAGCCATTgcattcttcttcgcg
aaTACGAGCAACGGGTGGCGATATTTGGCAGCTTTCCCGTGTGTGCTGGGCGCGCAATTCTTGCTCCTAGCCCCGACGCTGAGTGTGGAGAGTCCAGCGT
GGCTATTGACAAAGAATCGTCGTGAGGAGGCACGGAGGGTCATTGCGCGCTTGTACGGCGAAGAGAATGTAGGCACAGTTTTGTCCTGGCTTGAAGTGGG
GAACAAGGCAGCCAACGCTGAGCTGGGTAGGATTGCTGGCGAGCCGCCTGTGAATGAGTCCATGTTTGCCCCGCGCTACCGCCTCCAATTGGCAGGTGCA
GTCTTGCTTTCGTGCACACAGCAGCTCTCGGGCATCAACGCGGTGTTCTACTACTCCGGCACTATTTTCTCGGACGCCGGTATCTCAGATTCGCGCGTTG
GCACCTTGATCATCAACTTCATTAATATATGGCCTGCGTTCTTCACGGGAGTGCTGGCCGTCCGCCTAGGCAACCGTAACATGATCTTGTGGGGGTTGGC
AGGCATGGTGGCGATGTCGATCGGCATGACGGTGGCATTTATCGTCGATGTATCGGTGCTGTCGATCGTGTTTACAGCTTTGTACGTGATTGTGTTCGGC
GTGACGTTGGGCCCTTTGGTATGGGTGATGACCGCCGACATGTTCCCGGATTCTATTCGCGCGAGTGCGTCGTCGCTGTGTATTGGCATCAATTGGTTGT
GCAACCTAGTCGTAGGCGTGTCGTACCCGTACGTCTCGGATGCTCTTAACGGCTACGCGTACGTGCCATTCGTGGTGCTTTTGGTGATCTTTTACTTGCT
GGcgctgaagctggtgccgGAGACATCAGGTAAATCTGCTGAGGAGATTCAAGCAGAGTACGACTCGCGTCGCGAAATGTA
	
	
ATGTACCTCGAGGTCGTTGCCACACCCAACAAAGGTGTTGGTGTCCACATCAATGCGTTCGATGACGCCACGAAGGTCGCCGCACACCAACTCAAGCCCA
AGAGACTCCTGTACACGAGTGTTCTGGTCTCACTATTACAACCGTTCCAAAGCGGTTGGTCGACCTCGCAGATGAATCTGTCGCAGTACAACGATACGGC
CCAGTGTAATGCTCGTCCTGTGGCTGAAGGAACGTGCCTCATGTTCCCTGGCCACTCGAAGCTAGAGTGGACATTCGCAGTGAACGCATGGATCTTCGGT
GCTATGATCGGTTCTCTGTGCTGCGGCTACTTCAGCGACAAGCTAGGTCGCAAGAAGGTTTTGATGATCAACTGCGTCTTCATGATCGTTGGCGGCATGA
TCCAGGCGACCGTGTCCAACATTTGGCTGTTCGCCATTGGCCGCCTCATCGCCGGCTTGGCGTCGGGTACAGCCACAGGTACGATTGGTGCGTACGTGAA
CGAGCTATCGCCACCGCACATGCGCAACACGCTGGGTTTGGGTCTGCAGATTTCCACGACCATTGGCATCCTGCTCCCAGCCATTgcattcttcttcgcg
aaTACGAGCAACGGGTGGCGATATTTGGCAGCTTTCCCGTGTGTGCTGGGCGCGCAATTCTTGCTCCTAGCCCCGACGCTGAGTGTGGAGAGTCCAGCGT
GGCTATTGACAAAGAATCGTCGTGAGGAGGCACGGAGGGTCATTGCGCGCTTGTACGGCGAAGAGAATGTAGGCACAGTTTTGTCCTGGCTTGAAGTGGG
GAACAAGGCAGCCAACGCTGAGCTGGGTAGGATTGCTGGCGAGCCGCCTGTGAATGAGTCCATGTTTGCCCCGCGCTACCGCCTCCAATTGGCAGGTGCA
GTCTTGCTTTCGTGCACACAGCAGCTCTCGGGCATCAACGCGGTGTTCTACTACTCCGGCACTATTTTCTCGGACGCCGGTATCTCAGATTCGCGCGTTG
GCACCTTGATCATCAACTTCATTAATATATGGCCTGCGTTCTTCACGGGAGTGCTGGCCGTCCGCCTAGGCAACCGTAACATGATCTTGTGGGGGTTGGC
AGGCATGGTGGCGATGTCGATCGGCATGACGGTGGCATTTATCGTCGATGTATCGGTGCTGTCGATCGTGTTTACAGCTTTGTACGTGATTGTGTTCGGC
GTGACGTTGGGCCCTTTGGTATGGGTGATGACCGCCGACATGTTCCCGGATTCTATTCGCGCGAGTGCGTCGTCGCTGTGTATTGGCATCAATTGGTTGT
GCAACCTAGTCGTAGGCGTGTCGTACCCGTACGTCTCGGATGCTCTTAACGGCTACGCGTACGTGCCATTCGTGGTGCTTTTGGTGATCTTTTACTTGCT
GGcgctgaagctggtgccgGAGACATCAGGTAAATCTGCTGAGGAGATTCAAGCAGAGTACGACTCGCGTCGCGAAATGTAA
	
	
MYLEVVATPNKGVGVHINAFDDATKVAAHQLKPKRLLYTSVLVSLLQPFQSGWSTSQMNLSQYNDTAQCNARPVAEGTCLMFPGHSKLEWTFAVNAWIFG
AMIGSLCCGYFSDKLGRKKVLMINCVFMIVGGMIQATVSNIWLFAIGRLIAGLASGTATGTIGAYVNELSPPHMRNTLGLGLQISTTIGILLPAIAFFFA
NTSNGWRYLAAFPCVLGAQFLLLAPTLSVESPAWLLTKNRREEARRVIARLYGEENVGTVLSWLEVGNKAANAELGRIAGEPPVNESMFAPRYRLQLAGA
VLLSCTQQLSGINAVFYYSGTIFSDAGISDSRVGTLIINFINIWPAFFTGVLAVRLGNRNMILWGLAGMVAMSIGMTVAFIVDVSVLSIVFTALYVIVFG
VTLGPLVWVMTADMFPDSIRASASSLCIGINWLCNLVVGVSYPYVSDALNGYAYVPFVVLLVIFYLLALKLVPETSGKSAEEIQAEYDSRREM_