Scaffold : Scaffold_254
Gene_id : Hyaar_Emoy2813216
Description : hypothetical protein
ATGTGGTATTTTTTGTTGACGATCACGTCCAAGACCGCGTCCTTGCACAATCGGGACAGCATCCGGCTTCCGTACAACGTAGGTTTGACACAAAGCATTC
CTAAAAAATTGCGGTAGTATAGGCAGATGCGTGATCTGATTTTTCTTGATTGTGCGTGCCGTATCCATCAACAACAGACTAGTATACTGCCACATAAGTC
TCATTGCTGGTATCAACCAGTATGGTCATCGCCATGATCGCTAGCCACTGAAATTAATTTTAAAGGTGACGGTAAATGGACAATAGTGACTGCGTGTCGA
ACTGCGACGCTTCCGCGACTCTTCCTCTAAATTAGTTCTGTCAGTTCTTTTCACTATCCAGCTTTAGCAGCAACCAGCCAAAAATTCCTTGTCTTGCCTC
CCAGCAATTCTTCGAGCGACTTCTGAAAATGATTACTTATTATCAATCACATGAGCAAGTATATCAGATCGTACAAACGTTTGGTATATCCGGTATGGTG
TTTTGTTATTCACACATAAAGAGATCGATGAAACTGATAGGCGTATTATTGTACTCAATACGCAAAGCGGTAATACCGTACATTATCGATTACGGTTAGA
TGGTATCTATCGTAATAGGTATTCAGAGGGGCGGCGAAGTTGTGGTGTGGTACACCAGAAGAACCTTTATGAGGACTATTCGATTAGGTA
	
	
ATGTGGTATTTTTTGTTGACGATCACGTCCAAGACCGCGTCCTTGCACAATCGGGACAGCATCCGGCTTCCGTACAACGTAGATCGTACAAACGTTTGGT
ATATCCGGTATGGTGTTTTGTTATTCACACATAAAGAGATCGATGAAACTGATAGGCGTATTATTGTACTCAATACGCAAAGCGGTAATACCGTACATTA
TCGATTACGGTTAGATGGTATCTATCGTAATAGGTATTCAGAGGGGCGGCGAAGTTGTGGTGTGGTACACCAGAAGAACCTTTATGAGGACTATTCGATT
AGGTAG
	
	
MWYFLLTITSKTASLHNRDSIRLPYNVDRTNVWYIRYGVLLFTHKEIDETDRRIIVLNTQSGNTVHYRLRLDGIYRNRYSEGRRSCGVVHQKNLYEDYSI
R_