Scaffold : Scaffold_188
Gene_id : Hyaar_Emoy2812186
Description : hypothetical protein
ATGACGTGCGAGAGAAGGAGGACAAACAATGTCGCTGCATCATGTGCTGCCTCTTTACAAATTGGAGTCAACAAATCGAGCGTCACCACACTCGTGTTGT
GGTGCCCGAGAGCTGCTTTTATCTGCAGCTCCATCCAAAAAGCATTGAGACAGATAGTACACATGGGGTCCAATACTTCTCGTGACGAGAATGGGTCATC
GCGACGTCTTTGGAACTGGACCGTCGAGGACGAGACGCCACGTCTCATTGATGGAACCGCTTTCACTCCGAGTGGTGCAGCAGCTTCAGGTGTAGTAGGT
ATAGCCGACCAAGCGCGTAATCTTCTGGCTCTGAACTGCATCAAGTACAGCTCGTTCTTGGGTGATACCTGCCTTACCGGCTGTACCGATGGCTTGATCC
AGCGTCTCAATTGGCGGCTAAAAGCACGAGCCCCAGACAACGGCTTGAACGTGTGGATCCCTCACTCGGAGGCTGTGACTCAAGTGGTTATTGGAGCCAA
GCTGCAGATGATCTACTCGTGTTCACTTGACACGACGGTAGCCATTACGCCAATCACGGATAAACCGGCTTCAGAGACGGCGACAGTACTACGAGGTCAT
CGACTCTGTTTCGCTTCTGTGGCAGTTGATGACGCCGAGCAAATGCTGTGCTCAGGAGGACGAGACACACAGACGATCTTCTGGGACCTCACGACGAGTT
ATATTGCAGCCAAGACCACGACGCCCGAGAAAGTCGTCACGTGCTCGACGTGGTCGCCAGGTGAAGCGCTCGGTGCGTA
	
	
ATGACGTGCGAGAGAAGGAGGACAAACAATGTCGCTGCATCATGTGCTGCCTCTTTACAAATTGGAGTCAACAAATCGAGCGTCACCACACTCGTGTTGT
GGTGCCCGAGAGCTGCTTTTATCTGCAGCTCCATCCAAAAAGCATTGAGACAGATAGTACACATGGGGTCCAATACTTCTCGTGACGAGAATGGGTCATC
GCGACGTCTTTGGAACTGGACCGTCGAGGACGAGACGCCACGTCTCATTGATGGAACCGCTTTCACTCCGAGTGGTGCAGCAGCTTCAGGTGTAGTAGGT
ATAGCCGACCAAGCGCGTAATCTTCTGGCTCTGAACTGCATCAAGTACAGCTCGTTCTTGGGTGATACCTGCCTTACCGGCTGTACCGATGGCTTGATCC
AGCGTCTCAATTGGCGGCTAAAAGCACGAGCCCCAGACAACGGCTTGAACGTGTGGATCCCTCACTCGGAGGCTGTGACTCAAGTGGTTATTGGAGCCAA
GCTGCAGATGATCTACTCGTGTTCACTTGACACGACGGTAGCCATTACGCCAATCACGGATAAACCGGCTTCAGAGACGGCGACAGTACTACGAGGTCAT
CGACTCTGTTTCGCTTCTGTGGCAGTTGATGACGCCGAGCAAATGCTGTGCTCAGGAGGACGAGACACACAGACGATCTTCTGGGACCTCACGACGAGTT
ATATTGCAGCCAAGACCACGACGCCCGAGAAAGTCGTCACGTGCTCGACGTGGTCGCCAGGTGAAGCGCTCGGTGCGTAA
	
	
MTCERRRTNNVAASCAASLQIGVNKSSVTTLVLWCPRAAFICSSIQKALRQIVHMGSNTSRDENGSSRRLWNWTVEDETPRLIDGTAFTPSGAAASGVVG
IADQARNLLALNCIKYSSFLGDTCLTGCTDGLIQRLNWRLKARAPDNGLNVWIPHSEAVTQVVIGAKLQMIYSCSLDTTVAITPITDKPASETATVLRGH
RLCFASVAVDDAEQMLCSGGRDTQTIFWDLTTSYIAAKTTTPEKVVTCSTWSPGEALGA_