Scaffold : Scaffold_121
Gene_id : Phyci_286086
Description : Hypothetical protein
CGCATTTCGGATCCGGCGAGCATGGCGATCCCCAGCGGCGCGGCGGATTTCTTCGCGCTGCACACGCGCAAGCCCAAGACCATCGACGTGGAGATGCTGG
ACTACGGCTTCGTCGAGCGCTGCACCGACCTGGACGAGCTGAAGGGGATCCTGGCGACGCTCCGATCGGGCAAGGAAGGCCGCTACCCCGACCTGGAGAA
GGCCACGGAGGACCGCATCCTGGCGCTGCTGCCCGAGCGAGAGCGCAATAAGATCCTGCGCATGCGCTCAGGGCCGACCACGAACGAGCTGACCACGGAG
ATCGACGAGCTGGCGAACTGGGCTGCGGCGATGGACGTCAAGAACGAGGCGCTCAGGCGACAAGCGCCAGTCCAGCGAGAGCTGCCGCCTGTTCGAGGGC
AAAAAGCGTCTGAGGACACGCAGTCCAATTTGGTGCGAGCCCAGTCGAAACCAGCAAACTCCGAAAAGAAATCCAAAGCGATCCCGGCGTACGATTTCAG
GTCTTGGGAGAAGTACGACGTTGACAAGGCTCTGGAAGAGCTTGACGAAGAGAGCGAGCGAGCGCTCGAGCAGGCGAAACAGCAGCGAGAAGAGCAGGAA
AAACGAGCAGCGGCTCGGAAACGGGAGCTGGAGTCGCTTCCCAAGTCGGTGGAGCTTGATAGTCTCGAGCCGGAAGCACGGAAATTATACGCAGGGTATG
AAAAGCAAAAGGGGAACGACTGCTTTAAGGCAAACGAGCTGGAGATCGCGCTGTTGCACTACACTCGCAGTATGGCATACGACGACACTGACGCGATCCT
CTATGCCAATCGTGCATTGGTTCATCTTCGCATGAAGAACTTTGCGGCTGCTGAAGACGATTGCACGCGCTCCATTCTGCTCGACCCTAAATACATGAAG
GGGTGGAGTCGTCGTGGAATGACGCGATATCGGAGGGG
	
	
ATGGCGATCCCCAGCGGCGCGGCGGATTTCTTCGCGCTGCACACGCGCAAGCCCAAGACCATCGACGTGGAGATGCTGGACTACGGCTTCGTCGAGCGCT
GCACCGACCTGGACGAGCTGAAGGGGATCCTGGCGACGCTCCGATCGGGCAAGGAAGGCCGCTACCCCGACCTGGAGAAGGCCACGGAGGACCGCATCCT
GGCGCTGCTGCCCGAGCGAGAGCGCAATAAGATCCTGCGCATGCGCTCAGGGCCGACCACGAACGAGCTGACCACGGAGATCGACGAGCTGGCGAACTGG
GCTGCGGCGATGGACGTCAAGAACGAGGCGCTCAGGCGACAAGCGCCAGTCCAGCGAGAGCTGCCGCCTGTTCGAGGGCAAAAAGCGTCTGAGGACACGC
AGTCCAATTTGGTGCGAGCCCAGTCGAAACCAGCAAACTCCGAAAAGAAATCCAAAGCGATCCCGGCGTACGATTTCAGGTCTTGGGAGAAGTACGACGT
TGACAAGGCTCTGGAAGAGCTTGACGAAGAGAGCGAGCGAGCGCTCGAGCAGGCGAAACAGCAGCGAGAAGAGCAGGAAAAACGAGCAGCGGCTCGGAAA
CGGGAGCTGGAGTCGCTTCCCAAGTCGGTGGAGCTTGATAGTCTCGAGCCGGAAGCACGGAAATTATACGCAGGGTATGAAAAGCAAAAGGGGAACGACT
GCTTTAAGGCAAACGAGCTGGAGATCGCGCTGTTGCACTACACTCGCAGTATGGCATACGACGACACTGACGCGATCCTCTATGCCAATCGTGCATTGGT
TCATCTTCGCATGAAGAACTTTGCGGCTGCTGAAGACGATTGCACGCGCTCCATTCTGCTCGACCCTAAATACATGAAGGGGTGGAGTCGTCGTGGAATG
ACGCGATATCGGAGGGGC
	
	
MAIPSGAADFFALHTRKPKTIDVEMLDYGFVERCTDLDELKGILATLRSGKEGRYPDLEKATEDRILALLPERERNKILRMRSGPTTNELTTEIDELANW
AAAMDVKNEALRRQAPVQRELPPVRGQKASEDTQSNLVRAQSKPANSEKKSKAIPAYDFRSWEKYDVDKALEELDEESERALEQAKQQREEQEKRAAARK
RELESLPKSVELDSLEPEARKLYAGYEKQKGNDCFKANELEIALLHYTRSMAYDDTDAILYANRALVHLRMKNFAAAEDDCTRSILLDPKYMKGWSRRGM
TRYRRG