Scaffold : Scaffold_390
Gene_id : Sapdi_VS20SDRG_17448
Description : hypothetical protein
CGCTCACCAACGTCGCCAAGAAGGCGATCCCATCGGACGGCAAGATGACGTGGCAGAACCCCGACACGGGCGAAGGCTTCATCCCGAGCCACACGGTACC
CAACGACACTACTCTATGTATACTCAAGCTGCACTCATTGGTAGGGCCCCTGCGAGGTGTGGCTCGACAACAAGCGCGTGTTTCAGAACGACGACTGCGC
GACCAACTTTGGCGACAAGCCGGCCGCGCACCTCCCCGTCGACTACTCGAGCTGCGCGGGCGACGGCTGCATGCTGCGCTTTTACTGGATTGCGCTACAC
CAGCCTGAGTGGCAAGTCTACAGTGCGTCCCACGACCTTTATGGCTCCATGGCTCACGCTGCGATACTGTGCGTAGAAAACTGCGTTCCGCTGCAAGGCA
ACGGCCAGAACCCGGGGCCCGCGCCGCAGCCCAACAGCGGCGGCCAGTGCGCCAACGCCAAGAGCGACCTCGACTACTACGGCAACGACATCAAGAACCT
TGGGGTGTGGGGCAGTGCGCAAGACCAGCTCAGCCAGTGTTGCGCGGCGTGCAGCTCGACCAACGGCTGCGCCGGCTTCTCCATCAACAGCGGTGTGTGC
TGGCTCAAGCACACGCTCGGCAGCCCGACGCCCCGCGCTGGCGTCGTCTCGGCCTCTGCGCCCGGCGCCTCTGCGGGCTCGTCCAGCCAGTGCGGGAGCA
GCGTCAGCACCGACGTCGACTACTACGGCAACGACATCCGCAGCTTTGGCGTCAACGGCGACACGGCAGCGCAGGTCGCGCAGTGCTGCAACGGGTGCTC
GACCACGACCGGTTGCGTCGGCTTTTCGATCAACGCCAACACGTGCTGGCTCAAGAGCTCGGTGGCGAACCCGAGTCCTGCGAATGGTGTCGTTTCGGTT
CGCATGGCGCAGCACCGCCTTCGTCGCGCTCTCTAGAAAATGTCGCTTTCGTGTATTCTCTTGTTGCGTTGTATAAATGAAATGAAATTCCTGATTGACG
TTG
	
	
ATGACGTGGCAGAACCCCGACACGGGCGAAGGCTTCATCCCGAGCCACACGGGCCCCTGCGAGGTGTGGCTCGACAACAAGCGCGTGTTTCAGAACGACG
ACTGCGCGACCAACTTTGGCGACAAGCCGGCCGCGCACCTCCCCGTCGACTACTCGAGCTGCGCGGGCGACGGCTGCATGCTGCGCTTTTACTGGATTGC
GCTACACCAGCCTGAGTGGCAAGTCTACAAAAACTGCGTTCCGCTGCAAGGCAACGGCCAGAACCCGGGGCCCGCGCCGCAGCCCAACAGCGGCGGCCAG
TGCGCCAACGCCAAGAGCGACCTCGACTACTACGGCAACGACATCAAGAACCTTGGGGTGTGGGGCAGTGCGCAAGACCAGCTCAGCCAGTGTTGCGCGG
CGTGCAGCTCGACCAACGGCTGCGCCGGCTTCTCCATCAACAGCGGTGTGTGCTGGCTCAAGCACACGCTCGGCAGCCCGACGCCCCGCGCTGGCGTCGT
CTCGGCCTCTGCGCCCGGCGCCTCTGCGGGCTCGTCCAGCCAGTGCGGGAGCAGCGTCAGCACCGACGTCGACTACTACGGCAACGACATCCGCAGCTTT
GGCGTCAACGGCGACACGGCAGCGCAGGTCGCGCAGTGCTGCAACGGGTGCTCGACCACGACCGGTTGCGTCGGCTTTTCGATCAACGCCAACACGTGCT
GGCTCAAGAGCTCGGTGGCGAACCCGAGTCCTGCGAATGGTGTCGTTTCGGTTCGCATGGCGCAGCACCGCCTTCGTCGCGCTCTCTAG
	
	
MTWQNPDTGEGFIPSHTGPCEVWLDNKRVFQNDDCATNFGDKPAAHLPVDYSSCAGDGCMLRFYWIALHQPEWQVYKNCVPLQGNGQNPGPAPQPNSGGQ
CANAKSDLDYYGNDIKNLGVWGSAQDQLSQCCAACSSTNGCAGFSINSGVCWLKHTLGSPTPRAGVVSASAPGASAGSSSQCGSSVSTDVDYYGNDIRSF
GVNGDTAAQVAQCCNGCSTTTGCVGFSINANTCWLKSSVANPSPANGVVSVRMAQHRLRRAL_