Scaffold : Scaffold_1
Gene_id : Sapdi_VS20SDRG_00043
Description : TKL protein kinase
GCAAGAAATGGACCTCGTCGTCAAGGTTCCGCAGGCGCACGACCTCCGGAGCTCCAAGTTCTTTGGGAACGTCAAGCGCCCGTACGCGCTCGTGCGCTAC
GCCCACGACAGCGCCCAGACCGACGTCGACCCGGCTGGGCGGGAGGCGCCGCGCTGGAAGTTCCGCCACCGCTTCGCCAAAATCAACGTGGCCGCCTGCC
CGTACCTCCAGGTCGACGTCTACGATCTCGATACGCACGACGGGCCGGGCGCTGCGATCGGGACGTGCGAGGTTCCCGTGCCCACGAGCCCGTCCTGCTT
CCAGCAGTGGTTCAAGCTCTCGCTCCACGACAAGATCACGGGCTACATCTACATCGTGCTCGAGGTCGTGGCGCGGCGCCGTCGCGACGGCTCTAGCCAG
CGGTCCATCGACAGCGCCGAACGCCGATCAACCGCGAGCGTCGAGCGTCGGGCCTCCGATGAGCGCCGGGCGACTGCAAGCTCCGAGCGCAGGTCTACGG
CCAGCCTTGAGCGGCGACCCGAGCGGCGGCGCGACAGCGTCGTTTCGACCGCGTCGTCCAGCGGCAGCAGCGGGTCGGCCAAGAAGAAGACGGCGCTGCT
GTCATCGAGCTCGTCGCTCAGCGCGTCGTTCCTCCAGCGCACGGCAAGCCTGCCCGAGACAATTCCTCGCATCGACCCCGCTAATCTCCGGATGCGGTCG
GCGCTCGGTCGCGGCGCGTACGGCTCGGTTGCGCTGTGCATCTACAAGAAGCGTCCTGTCGCTGTCAAGACGTTCCACGTCACGAGCGGCAACGTCAACG
GCGACGACCACGAGTCGTTTGCAAAGGAAGTCGGCGTCATGTACCGCCTCAGCTCGTTCTACACGGTGCAGCTCCTCGGCATCTCGCACAACGAGCACGA
CCAGCCGCAGATCGTGATGGAGTACATGAGCGGCGGCAACCTGCACGAACATCTCAAGCTGCTTGGCGCCACTGACGACACCGACCACGACGTCACCTCG
CTACTCTTCATTGCGCTGAGCGTCGCCAAAGGCTTGGTGTACCTCCACAACCAAAGCATCATCCACCGCGACCTCAAGCCCGCCAACGTGCTCCTGAGCG
ACGACAAGGTGTCGGTCAAGCTCGGCGACTTCGGTATCTCGCGGCAATATGACGTCGAGTCGATGACCAACGGCATCGGCACGACGCCGTGGATGGCCCC
CGAAGTCATCAGCAGCGGCAACTACACGGTGCAAGCCGACATCTACTCGTTTGGCATCCTCCTCACCGAGCTCGATACGCTCAAAGCGCCGTACGCCGGC
GAAAAGTGCAGTCCGTTCGTCCTACAAGGCAGAGTCCTCAACGGGTACCGGCCCGCGCTGCGCCCGACAGCACCAGCTTGGTACAAGCGCCTCGTGGCCA
GCTGCGTAGCCACCGACCCAAACAACCGCCCGACGGCGGCCGAGATTGTCGAGATCCTCACCGACCAGATGCCAACGTCCCGCCGCCTGGTGCTGCCATC
AGTGACACTGCCCCAGATCCCGCCGTCCGAGGTGGCGCCCGTCGGTGTTGTCGGTGGCAACGCGTTCAGCTCCGTCGCCCGCGGGATTTACGGCGACCGT
ATGGTCGCGATCAAGACGTTCCTGACGCTGCACCCATCGAGGGTCGAAGCGGCGGCCAACCGCATGGCACGCCTTGGGTCCGAGCACACGGTTGAGCTTC
TCGGCCTCGCCGGCTCGACGCTCGTGATGGAGTGCATGCTGAATGGCAACCTGCGGCAGTTCCTCGCACAGAAAGCGCGGCAGGCGTGGCCGGCCCAGGA
CCTGCGCAACGTCCTGTATGTCGCGGTGGCGCTCGCTAAAGGGCTGGCGTTCTTGCACGCGAACGACCAAGTCCACGGCAGCCTCGTGCCGACCAACGTC
CTCTTTGATGCCAAGGGCGTCGTCAAGCTCAGTGACTTTGGCTACGACCGCGACGACGACGACGTGACGGTGAGCGGCGCGTCGACGATGGCCTACCTAG
CGCCCGAAGTGCTCTTGGGGCAGCCGCCGTCGTTTCCTGCCGACGTCTTTGCCCTTGGCGTCCTCTTCACGCAGCTCGAGACGCTCCAAGAGCCGTATGC
TGACAACCACAGTGCGCTGACAAAGAAGGTCGCGCAGGTCTCGGCCGGCTTGCTCCGACCGACGCTGAGTCCGTCGTGCCCCGCCTGGTTCCGGGACCTA
TCGCTTCTGTGCATGGCCCAAGACCCGACTCGTCGTCCGACGGCCGCCGACGTTGTCCAGCTCCTGAGCGACAATATGCAGTAGCTAGTATAATGGCGCC
AACTATGTATTATTTGCTATGTAAT
	
	
ATGGACCTCGTCGTCAAGGTTCCGCAGGCGCACGACCTCCGGAGCTCCAAGTTCTTTGGGAACGTCAAGCGCCCGTACGCGCTCGTGCGCTACGCCCACG
ACAGCGCCCAGACCGACGTCGACCCGGCTGGGCGGGAGGCGCCGCGCTGGAAGTTCCGCCACCGCTTCGCCAAAATCAACGTGGCCGCCTGCCCGTACCT
CCAGGTCGACGTCTACGATCTCGATACGCACGACGGGCCGGGCGCTGCGATCGGGACGTGCGAGGTTCCCGTGCCCACGAGCCCGTCCTGCTTCCAGCAG
TGGTTCAAGCTCTCGCTCCACGACAAGATCACGGGCTACATCTACATCGTGCTCGAGGTCGTGGCGCGGCGCCGTCGCGACGGCTCTAGCCAGCGGTCCA
TCGACAGCGCCGAACGCCGATCAACCGCGAGCGTCGAGCGTCGGGCCTCCGATGAGCGCCGGGCGACTGCAAGCTCCGAGCGCAGGTCTACGGCCAGCCT
TGAGCGGCGACCCGAGCGGCGGCGCGACAGCGTCGTTTCGACCGCGTCGTCCAGCGGCAGCAGCGGGTCGGCCAAGAAGAAGACGGCGCTGCTGTCATCG
AGCTCGTCGCTCAGCGCGTCGTTCCTCCAGCGCACGGCAAGCCTGCCCGAGACAATTCCTCGCATCGACCCCGCTAATCTCCGGATGCGGTCGGCGCTCG
GTCGCGGCGCGTACGGCTCGGTTGCGCTGTGCATCTACAAGAAGCGTCCTGTCGCTGTCAAGACGTTCCACGTCACGAGCGGCAACGTCAACGGCGACGA
CCACGAGTCGTTTGCAAAGGAAGTCGGCGTCATGTACCGCCTCAGCTCGTTCTACACGGTGCAGCTCCTCGGCATCTCGCACAACGAGCACGACCAGCCG
CAGATCGTGATGGAGTACATGAGCGGCGGCAACCTGCACGAACATCTCAAGCTGCTTGGCGCCACTGACGACACCGACCACGACGTCACCTCGCTACTCT
TCATTGCGCTGAGCGTCGCCAAAGGCTTGGTGTACCTCCACAACCAAAGCATCATCCACCGCGACCTCAAGCCCGCCAACGTGCTCCTGAGCGACGACAA
GGTGTCGGTCAAGCTCGGCGACTTCGGTATCTCGCGGCAATATGACGTCGAGTCGATGACCAACGGCATCGGCACGACGCCGTGGATGGCCCCCGAAGTC
ATCAGCAGCGGCAACTACACGGTGCAAGCCGACATCTACTCGTTTGGCATCCTCCTCACCGAGCTCGATACGCTCAAAGCGCCGTACGCCGGCGAAAAGT
GCAGTCCGTTCGTCCTACAAGGCAGAGTCCTCAACGGGTACCGGCCCGCGCTGCGCCCGACAGCACCAGCTTGGTACAAGCGCCTCGTGGCCAGCTGCGT
AGCCACCGACCCAAACAACCGCCCGACGGCGGCCGAGATTGTCGAGATCCTCACCGACCAGATGCCAACGTCCCGCCGCCTGGTGCTGCCATCAGTGACA
CTGCCCCAGATCCCGCCGTCCGAGGTGGCGCCCGTCGGTGTTGTCGGTGGCAACGCGTTCAGCTCCGTCGCCCGCGGGATTTACGGCGACCGTATGGTCG
CGATCAAGACGTTCCTGACGCTGCACCCATCGAGGGTCGAAGCGGCGGCCAACCGCATGGCACGCCTTGGGTCCGAGCACACGGTTGAGCTTCTCGGCCT
CGCCGGCTCGACGCTCGTGATGGAGTGCATGCTGAATGGCAACCTGCGGCAGTTCCTCGCACAGAAAGCGCGGCAGGCGTGGCCGGCCCAGGACCTGCGC
AACGTCCTGTATGTCGCGGTGGCGCTCGCTAAAGGGCTGGCGTTCTTGCACGCGAACGACCAAGTCCACGGCAGCCTCGTGCCGACCAACGTCCTCTTTG
ATGCCAAGGGCGTCGTCAAGCTCAGTGACTTTGGCTACGACCGCGACGACGACGACGTGACGGTGAGCGGCGCGTCGACGATGGCCTACCTAGCGCCCGA
AGTGCTCTTGGGGCAGCCGCCGTCGTTTCCTGCCGACGTCTTTGCCCTTGGCGTCCTCTTCACGCAGCTCGAGACGCTCCAAGAGCCGTATGCTGACAAC
CACAGTGCGCTGACAAAGAAGGTCGCGCAGGTCTCGGCCGGCTTGCTCCGACCGACGCTGAGTCCGTCGTGCCCCGCCTGGTTCCGGGACCTATCGCTTC
TGTGCATGGCCCAAGACCCGACTCGTCGTCCGACGGCCGCCGACGTTGTCCAGCTCCTGAGCGACAATATGCAGTAG
	
	
MDLVVKVPQAHDLRSSKFFGNVKRPYALVRYAHDSAQTDVDPAGREAPRWKFRHRFAKINVAACPYLQVDVYDLDTHDGPGAAIGTCEVPVPTSPSCFQQ
WFKLSLHDKITGYIYIVLEVVARRRRDGSSQRSIDSAERRSTASVERRASDERRATASSERRSTASLERRPERRRDSVVSTASSSGSSGSAKKKTALLSS
SSSLSASFLQRTASLPETIPRIDPANLRMRSALGRGAYGSVALCIYKKRPVAVKTFHVTSGNVNGDDHESFAKEVGVMYRLSSFYTVQLLGISHNEHDQP
QIVMEYMSGGNLHEHLKLLGATDDTDHDVTSLLFIALSVAKGLVYLHNQSIIHRDLKPANVLLSDDKVSVKLGDFGISRQYDVESMTNGIGTTPWMAPEV
ISSGNYTVQADIYSFGILLTELDTLKAPYAGEKCSPFVLQGRVLNGYRPALRPTAPAWYKRLVASCVATDPNNRPTAAEIVEILTDQMPTSRRLVLPSVT
LPQIPPSEVAPVGVVGGNAFSSVARGIYGDRMVAIKTFLTLHPSRVEAAANRMARLGSEHTVELLGLAGSTLVMECMLNGNLRQFLAQKARQAWPAQDLR
NVLYVAVALAKGLAFLHANDQVHGSLVPTNVLFDAKGVVKLSDFGYDRDDDDVTVSGASTMAYLAPEVLLGQPPSFPADVFALGVLFTQLETLQEPYADN
HSALTKKVAQVSAGLLRPTLSPSCPAWFRDLSLLCMAQDPTRRPTAADVVQLLSDNMQ_