Scaffold : Scaffold_1
Gene_id : Sapdi_VS20SDRG_00019
Description : Ras-like protein Rab-11B
ACTGAATCCAAGTCAACGCGAGAAAATGGGGTGGTCGCGATCGGGCCGCATCATCGAATTTGGTCGGGCGATGGCCGAAGGAGGAAGAGCGACGTCGCCG
CCCCCGCCGCCGGCGGCCATGGCCCACACCAGCAGCTCCATGAGCGACGTCTCTTCCGCGGCCGGCGAGCAGGAGTATGTGCTCAAGGTCGTCCTCATCG
GCGACTCGGGCGTCGGCAAGAGCAACCTCGTCCAGCGCTTCACCAAGAACAAGTACAACGAAGCGAGCACGCAGACCATCGGTACGTTGCGCCCAATATG
GCGTCGCCTCTAAGAACGTATAGGCTTTGAGTTTGCGGCCAAGACCATCCGCGTCGGCGACCGCCGCATCAAGGCGCAGATCTGGGACACGGCCGGCCAG
GAGCGCTTCCAGTCGCTGACGGCCGCCTACTACCGCAACGCAGTCGGCGCGCTCATCGTCTACGACATTACGAACCGTGCGTCGTTCGAGCATGTTACGC
ACTGGCTCGCGCAGATCCACGAGCACGCCCATGAGAACGTCGTCTTGATCCTTGTCGGCAACAAGTGCGACCTCGCCCACCGCCCCAACACGCGGTACGT
ACATGCTTGTTTTGCCGACCTCTGTGTCTGATGGCACTTCTTGCAGGCAAGTGTCGACGCTCGAGGCTGCTCGGTTCGCCGAGACGCACCACATGGAGTT
TGTCGAGGCGTCGGCGCTCGACTCGACCAACGTCGTCGAGGCCTTCAAGCGCATCATCGTTCCCGTCGGTCGGCTGCTCATGCCGACCAACACCAACTCG
ACGCCGCGGTTACCGCCGGGGTGGCGGCGCGTGCTCTCGCGCACACGACCGGGCGAGTACTCGTACGAGAACCAGTACACAAAGGAGCGACTCGCATTTG
CGCCCAAGGAGGCGGCCAAGCCATCGCAGTACAGCTTCCAGCATGCGGCGCGCAGTGCAAGCTCGGGCGGCAGCAACAAGAGTCTCCAGGGCCCCGCAGG
CGTCACGGTCACCAAGGAAGCTTTGGAGCGCCAGCATCAAAAGGCTTTTCTGGCCCAGCAGTCGGCGTCGCCCAACTGCACGTCGCTCTTCTCGGGCGCG
TGCTGCACGATCCTTTAACCCGTTTTTCTAATATAAACCCGTCTCACATTTTGCCACGTCAT
	
	
ATGGGGTGGTCGCGATCGGGCCGCATCATCGAATTTGGTCGGGCGATGGCCGAAGGAGGAAGAGCGACGTCGCCGCCCCCGCCGCCGGCGGCCATGGCCC
ACACCAGCAGCTCCATGAGCGACGTCTCTTCCGCGGCCGGCGAGCAGGAGTATGTGCTCAAGGTCGTCCTCATCGGCGACTCGGGCGTCGGCAAGAGCAA
CCTCGTCCAGCGCTTCACCAAGAACAAGTACAACGAAGCGAGCACGCAGACCATCGGCTTTGAGTTTGCGGCCAAGACCATCCGCGTCGGCGACCGCCGC
ATCAAGGCGCAGATCTGGGACACGGCCGGCCAGGAGCGCTTCCAGTCGCTGACGGCCGCCTACTACCGCAACGCAGTCGGCGCGCTCATCGTCTACGACA
TTACGAACCGTGCGTCGTTCGAGCATGTTACGCACTGGCTCGCGCAGATCCACGAGCACGCCCATGAGAACGTCGTCTTGATCCTTGTCGGCAACAAGTG
CGACCTCGCCCACCGCCCCAACACGCGGCAAGTGTCGACGCTCGAGGCTGCTCGGTTCGCCGAGACGCACCACATGGAGTTTGTCGAGGCGTCGGCGCTC
GACTCGACCAACGTCGTCGAGGCCTTCAAGCGCATCATCGTTCCCGTCGGTCGGCTGCTCATGCCGACCAACACCAACTCGACGCCGCGGTTACCGCCGG
GGTGGCGGCGCGTGCTCTCGCGCACACGACCGGGCGAGTACTCGTACGAGAACCAGTACACAAAGGAGCGACTCGCATTTGCGCCCAAGGAGGCGGCCAA
GCCATCGCAGTACAGCTTCCAGCATGCGGCGCGCAGTGCAAGCTCGGGCGGCAGCAACAAGAGTCTCCAGGGCCCCGCAGGCGTCACGGTCACCAAGGAA
GCTTTGGAGCGCCAGCATCAAAAGGCTTTTCTGGCCCAGCAGTCGGCGTCGCCCAACTGCACGTCGCTCTTCTCGGGCGCGTGCTGCACGATCCTTTAA
	
	
MGWSRSGRIIEFGRAMAEGGRATSPPPPPAAMAHTSSSMSDVSSAAGEQEYVLKVVLIGDSGVGKSNLVQRFTKNKYNEASTQTIGFEFAAKTIRVGDRR
IKAQIWDTAGQERFQSLTAAYYRNAVGALIVYDITNRASFEHVTHWLAQIHEHAHENVVLILVGNKCDLAHRPNTRQVSTLEAARFAETHHMEFVEASAL
DSTNVVEAFKRIIVPVGRLLMPTNTNSTPRLPPGWRRVLSRTRPGEYSYENQYTKERLAFAPKEAAKPSQYSFQHAARSASSGGSNKSLQGPAGVTVTKE
ALERQHQKAFLAQQSASPNCTSLFSGACCTIL_