Scaffold : Scaffold_1
Gene_id : Sapdi_VS20SDRG_00009
Description : hypothetical protein
TTCCGAATCATCATGTTCTCCCCAAACCACTCTGCACCTTCCTCCTCGTTCGACCGTGCGTGCAGTGCCAGCGCAGTGTTCACGAACCCGTCGCTCGTCG
TCGCCATCTTTGGGTTTTGCCCCAGCTGCCTCGACGTATGCCCAAAGCTCTACGAGGTTCGCGGCTCGAGGGGAGATCCGTACTACTACCTCGTTGCGAG
CCTCGCCGGCAAGCACGTCACCAACGGCTACGTCGACCACGAAGCCAACCTTTGCCGCGACGAGCTCGTGGCGCGCGCCAAGGCCAGTGTCAAGGACCAC
AAGGCTTTGTATCGCGCTCTTGCCGTGCGCCACAAGATGGCCGAGATCGTCGCGCCCATCTCACACCACCACTTTCGGCAGGCCGGCGGCATCCACCAAT
TTGACATCTACGACGTACGCCCGACGCTGTTTGCGCCAAGCTGCCGCGTGGACCCGACGTCGACGACGTGGGGTCGTGACGATTTGGTCAAGATTTTCAA
CTGCGACGGAATCGAGTTTCGTGAGAACGGGATGGGTGTCCCCAACGGCGTTGCATGGCACTGGTACAACGCGTCCGAGGACGGTAGTTGCGCCTTCTGC
GCGACGGCTGGCACCGTCGAGATCGACTACGCGCGGCAAGACGAGTGCTCGTACGGCGAGTACAACGAGATTTCGGCCAACTGGCGCGCATTCATCACCG
CCCACGGGCTGCACATCAATGCGTTCCGAAGCGGGCGCAGCGGCGCTCAGATGGCGCTCGTAACAAACAGCGACGCGCACCGCGCCTTTTGCCGCGACGT
CGTGCAGCCGTTGCGAGCGCATCTCACTGCGCATCTGAGCGACGTCAAGTTCGTCACGCTCGCCTACTGCGACGACGTCGACCAGGTCATG
	
	
ATGTTCTCCCCAAACCACTCTGCACCTTCCTCCTCGTTCGACCGTGCGTGCAGTGCCAGCGCAGTGTTCACGAACCCGTCGCTCGTCGTCGCCATCTTTG
GGTTTTGCCCCAGCTGCCTCGACGTATGCCCAAAGCTCTACGAGGTTCGCGGCTCGAGGGGAGATCCGTACTACTACCTCGTTGCGAGCCTCGCCGGCAA
GCACGTCACCAACGGCTACGTCGACCACGAAGCCAACCTTTGCCGCGACGAGCTCGTGGCGCGCGCCAAGGCCAGTGTCAAGGACCACAAGGCTTTGTAT
CGCGCTCTTGCCGTGCGCCACAAGATGGCCGAGATCGTCGCGCCCATCTCACACCACCACTTTCGGCAGGCCGGCGGCATCCACCAATTTGACATCTACG
ACGTACGCCCGACGCTGTTTGCGCCAAGCTGCCGCGTGGACCCGACGTCGACGACGTGGGGTCGTGACGATTTGGTCAAGATTTTCAACTGCGACGGAAT
CGAGTTTCGTGAGAACGGGATGGGTGTCCCCAACGGCGTTGCATGGCACTGGTACAACGCGTCCGAGGACGGTAGTTGCGCCTTCTGCGCGACGGCTGGC
ACCGTCGAGATCGACTACGCGCGGCAAGACGAGTGCTCGTACGGCGAGTACAACGAGATTTCGGCCAACTGGCGCGCATTCATCACCGCCCACGGGCTGC
ACATCAATGCGTTCCGAAGCGGGCGCAGCGGCGCTCAGATGGCGCTCGTAACAAACAGCGACGCGCACCGCGCCTTTTGCCGCGACGTCGTGCAGCCGTT
GCGAGCGCATCTCACTGCGCATCTGAGCGACGTCAAGTCATGA
	
	
MFSPNHSAPSSSFDRACSASAVFTNPSLVVAIFGFCPSCLDVCPKLYEVRGSRGDPYYYLVASLAGKHVTNGYVDHEANLCRDELVARAKASVKDHKALY
RALAVRHKMAEIVAPISHHHFRQAGGIHQFDIYDVRPTLFAPSCRVDPTSTTWGRDDLVKIFNCDGIEFRENGMGVPNGVAWHWYNASEDGSCAFCATAG
TVEIDYARQDECSYGEYNEISANWRAFITAHGLHINAFRSGRSGAQMALVTNSDAHRAFCRDVVQPLRAHLTAHLSDVKS_