Scaffold : Scaffold_1
Gene_id : Sappa_CBS223.65SPRG_00029
Description : phox domain-containing protein, partial
TCGCCGACAAGATCTGGCTGGCATGGCGTCGTCGCGGTCGCTGCCATCGATGGACGCGCGGCCACCTCTCGGTGCCAAGGTCGGTGAAGCGCATCGACCT
GCCATCGACATCATCGCCACGTACATGAACTCGTCGGACAACCGGCTCAACGCCAAGTCTGACAGCGCGCGGTCCGTGCATGGCTCTGGCGATCTCAAGC
GGCCGTCGTCGCAAGTGCAGAGCCGCGACAGCAGCGCCGAGTGGGGCTGGTTCCACGACATCGACAGCAGCGTCGAGTCGATGGGCGACAACTCGATGAT
GGGCATGCCACGGCGGCGGTACAGCGGCGGCGACTCAGGCGGCCACATCATCCACGACGAGCAGCAGAGCTTGAGCCGCATTACGGCGCTCAAAACGTTC
CCGAACGATGGCAAGGTGCTCACGGCCGCCGTGTCGATCCCCAAGTTCCGCATCGTACAGAACCGCGCCGGTGCCGACCGCCACGCCGAGTACCTCGTGA
CGTTCAAGCTCGGGCGCGAGTACCACACCGACTGGCGGCGCTACTCGGAGTTTGAAGGCATCGTCAAGAAGCTCGAGATGGGACTCTACCCGCGGGCAAG
CGTTGCGTGGCGCGCTGTCGACAACCGCTGGTTCAACCGGCTCGAGCCGAGCTACCTGCACAAAAAGTGCATTGCGCTCGAGGTGTTTCTTCGGGACCTC
ATGTACGAGCTCCTCGAGCCCGACGTCTTTATCGACTTTCTCGGCAGTCGCGTCAACTCGCGCCCGTCCGACGCCTCAGCTGAGCGCGCCGCCGCCCAGC
TGCCCAAGGAGCTACGCCCGCCCCAGCCCCAGGAGGAGCGCGAGCTCTTTGAGAAGCTCTGGGCCGAAAACTTCAAGCGGTCGGCCGTCAACTACACTGA
ACCAGTCGTCGCCGACGGCTGACCTATTTACACATAACACTATTACGAGTGCAGCTACTCGTATCGTCGTCCCACGCCCATTGCCTTGACATGCAGCCAG
TACACTAGCACCTGCTC
	
	
ATGGCGTCGTCGCGGTCGCTGCCATCGATGGACGCGCGGCCACCTCTCGGTGCCAAGGTCGGTGAAGCGCATCGACCTGCCATCGACATCATCGCCACGT
ACATGAACTCGTCGGACAACCGGCTCAACGCCAAGTCTGACAGCGCGCGGTCCGTGCATGGCTCTGGCGATCTCAAGCGGCCGTCGTCGCAAGTGCAGAG
CCGCGACAGCAGCGCCGAGTGGGGCTGGTTCCACGACATCGACAGCAGCGTCGAGTCGATGGGCGACAACTCGATGATGGGCATGCCACGGCGGCGGTAC
AGCGGCGGCGACTCAGGCGGCCACATCATCCACGACGAGCAGCAGAGCTTGAGCCGCATTACGGCGCTCAAAACGTTCCCGAACGATGGCAAGGTGCTCA
CGGCCGCCGTGTCGATCCCCAAGTTCCGCATCGTACAGAACCGCGCCGGTGCCGACCGCCACGCCGAGTACCTCGTGACGTTCAAGCTCGGGCGCGAGTA
CCACACCGACTGGCGGCGCTACTCGGAGTTTGAAGGCATCGTCAAGAAGCTCGAGATGGGACTCTACCCGCGGGCAAGCGTTGCGTGGCGCGCTGTCGAC
AACCGCTGGTTCAACCGGCTCGAGCCGAGCTACCTGCACAAAAAGTGCATTGCGCTCGAGGTGTTTCTTCGGGACCTCATGTACGAGCTCCTCGAGCCCG
ACGTCTTTATCGACTTTCTCGGCAGTCGCGTCAACTCGCGCCCGTCCGACGCCTCAGCTGAGCGCGCCGCCGCCCAGCTGCCCAAGGAGCTACGCCCGCC
CCAGCCCCAGGAGGAGCGCGAGCTCTTTGAGAAGCTCTGGGCCGAAAACTTCAAGCGGTCGGCCGTCAACTACACTGAACCAGTCGTCGCCGACGGCTGA
	
	
MASSRSLPSMDARPPLGAKVGEAHRPAIDIIATYMNSSDNRLNAKSDSARSVHGSGDLKRPSSQVQSRDSSAEWGWFHDIDSSVESMGDNSMMGMPRRRY
SGGDSGGHIIHDEQQSLSRITALKTFPNDGKVLTAAVSIPKFRIVQNRAGADRHAEYLVTFKLGREYHTDWRRYSEFEGIVKKLEMGLYPRASVAWRAVD
NRWFNRLEPSYLHKKCIALEVFLRDLMYELLEPDVFIDFLGSRVNSRPSDASAERAAAQLPKELRPPQPQEERELFEKLWAENFKRSAVNYTEPVVADG_