Scaffold : Scaffold_1
Gene_id : Pytul_var.sporangiiferummaker-pug3_contig_1-snap-gene-0.51
Description : Oxidoreductase, 2OG-Fe(II) oxygenase family family protein
ATGGCAAACCAAAACGACAAGCGCGCGCTCGAGGATGAGATCGACGTGTCGTCGTCAGCCTGCTCAGAGTCCGTTGCGCCGAAGAAGCAGCGCGCGAGCA
CCACAGACCAGAAGCACAGCGTCATCCGCAGTAGCAGTTCTACCAGCCATCTATCACAAGCGTTTACGTGCGAAAACGTGGTTGCTCATGCAAGACAGGT
GACGGCATCTATCTCCAAAGAAATCGACGTCGATAAAGTGTTTGCGGACGCGAAAGTTCACTATCTCACGCGTGACCGCGCGAGTTGGGTGTACCACGTA
CCTCGCTGNNNNNNNNNNNNNNNNNNNNCTGGTATCGCCGCATGTACACCTTCTGTGATGACGACCGCCATGGTTCATACAGGGAGTGGCTGGGTCGCAT
CTGGACGTTGCATCCAGTAGATCATGGCACGATCAAGATGTTTGGCCGCGACGTCCTCACGCCACGTTTTCAGCAAGCGTACGGAGTGAGCTATCGATTC
TCAGGCAACACGTTTCAAGCAGTTCCTGTTCCAGAATCGCTCCAGCACTGCGTGGAGTTGATGCAAGCGATGGTCATGAACCCAGCCACCGACAGCACGC
TTCTCAACGGCATTCTGTTGAATTGGTACGCGGACGGAGACCACTATATCGGCCCTCACTCTGATAGTGTGGGGGCCTTGTACAAGCACTCACCAGTGTT
TTCGCTCTCGCTCGGCGCGACGCGAAGATTTGTGTTTACGGCCAAGACAGGCAAGTCGAGCGCAGGCAATGACAGAAACGGAGCCGTCCAGCGACTGGAA
CTTGCTCTCCAGAGCGGCGATTTGGTAGTTATGGGTGGCACGACGCAGCAAACGCATAAGCACGCACTACCAAAGATGAAGAGTTGCATCGAGAAACGCG
TGAGCATCACACTGCGGTGCTTCGTCACGCCATCCTA
	
	
ATGGCAAACCAAAACGACAAGCGCGCGCTCGAGGATGAGATCGACGTGTCGTCGTCAGCCTGCTCAGAGTCCGTTGCGCCGAAGAAGCAGCGCGCGAGCA
CCACAGACCAGAAGCACAGCGTCATCCGCAGTAGCAGTTCTACCAGCCATCTATCACAAGCGTTTACGTGCGAAAACGTGGTTGCTCATGCAAGACAGGT
GACGGCATCTATCTCCAAAGAAATCGACGTCGATAAAGTGTTTGCGGACGCGAAAGTTCACTATCTCACGCGTGACCGCGCGAGTTGGGTGTACCACTGG
CTGGGTCGCATCTGGACGTTGCATCCAGTAGATCATGGCACGATCAAGATGTTTGGCCGCGACGTCCTCACGCCACGTTTTCAGCAAGCGTACGGAGTGA
GCTATCGATTCTCAGGCAACACGTTTCAAGCAGTTCCTGTTCCAGAATCGCTCCAGCACTGCGTGGAGTTGATGCAAGCGATGGTCATGAACCCAGCCAC
CGACAGCACGCTTCTCAACGGCATTCTGTTGAATTGGTACGCGGACGGAGACCACTATATCGGCCCTCACTCTGATAGTGTGGGGGCCTTGTACAAGCAC
TCACCAGTGTTTTCGCTCTCGCTCGGCGCGACGCGAAGATTTGTGTTTACGGCCAAGACAGGCAAGTCGAGCGCAGGCAATGACAGAAACGGAGCCGTCC
AGCGACTGGAACTTGCTCTCCAGAGCGGCGATTTGGTAGTTATGGGTGGCACGACGCAGCAAACGCATAAGCACGCACTACCAAAGATGAAGAGTTGCAT
CGAGAAACGCGTGAGCATCACACTGCGGTGCTTCGTCACGCCATCCTAG
	
	
MANQNDKRALEDEIDVSSSACSESVAPKKQRASTTDQKHSVIRSSSSTSHLSQAFTCENVVAHARQVTASISKEIDVDKVFADAKVHYLTRDRASWVYHW
LGRIWTLHPVDHGTIKMFGRDVLTPRFQQAYGVSYRFSGNTFQAVPVPESLQHCVELMQAMVMNPATDSTLLNGILLNWYADGDHYIGPHSDSVGALYKH
SPVFSLSLGATRRFVFTAKTGKSSAGNDRNGAVQRLELALQSGDLVVMGGTTQQTHKHALPKMKSCIEKRVSITLRCFVTPS_