Scaffold : Scaffold_1
Gene_id : Pytul_var.sporangiiferumfgenesh_masked-pug3_contig_1-abinit-gene-0.155
Description : Translocation protein SEC63
ATGCTCGAGTACGACAACTCAGCGTTCTACTACTTTTCCATCTCGCTCGGCGTGCTCTATGTGGTGCCGGCCACGTACCTGTCGCTGCGCCGCATCGTGN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTCAAGGACCGCCTCATCGACCGCCAGAACATCCGCTGCGACCGCGAGCTGCGCAAGATGAAGCAGCTGC
AGGCCGAGAAGACCAAGTTCTCGAACGTGTTCTCGCCGCTCTTTCTGCTCAACCTCGTTGTGCTCGCAGGTCTCTGGTACGGACTCTACCAGATGGCCAT
CTTACTCAAGGACGACTCGGAGATCAAGTCGTTTGACCCGTTTGCGATCCTAGGCATCGCAGCCGGCGCCTCGGAGCGCGAGATCAAGCGCGCCTACCGC
AAGATGAGTCTGATTTACCACCCAGACAAGAACATTGGCGATGCTGTCGCTGAACAGAAGTTTATGCTCGTTGCCAAGGCGTACGAAGCGCTGACGGATG
AAGTTGCCAAGGCCAACTACGAGAAATTTGGCAACCCGGATGGTCGTCAGGCGCTGCAACTGTCCATTGGTCTACCGACGTTCCTATTGGACCCTGCGAA
CCACAACATTGTGCTCTTCTTGTACTTGATCATCTTGGTCGTTGCGATCCCATCGTGCGTGGCGCTCTGGTACTCGCACTCGAAGAAGTATGGTGACAGC
ATGATCATGTACGACACGTACGGATTCTACAACTTTGCGATGTCGGAGCACGCGCACCCACGCATGCTGCCAGAAGTGCTCGCCGGCTCGGCGGAATTCC
GTGAGATCCCAAAGCGCGCGTCGGACGACGCAGAATTGGGTGCGCTCTTCCGTAAGTTTAAGCAGCAGGATTTGATCTCGAAGCCAAAGTACAACCATCC
ATCGATTGCCAAGGCGAACATCCTCATCCACGCACACTTCTTACGTGAAAAGCTGAGTCCGGCGTTGACGGGTGACTTGCACGCGATGCTGAAGAAGGCG
ATCCAATTGGTGGACGGCATGCTCGAGATCTCGGTCGGCAAGTCGTGGCTGCAGACGACGCTGAACTTGATTGAAATGGAGCAATTCCTCACGCAGGCGT
TGTTCTTTAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGCAATTGCCGCACTTCACGGAGAACGAAGTGCGCCACATCCTCACGGGCAAGAACGCT
GTGCGCAGCATGCACCAGTACGTCGATATGGACCCGAAGGACCGCAAGGGCTTGAACGACTTGAACGACGAACAGAAGGCTGAAGTCAACAAGGTGCTGG
AAATGATGCCGAACGTGGAGCTCAACATCACAATCGCGGTCGACGACGAAGAGGAGATCGCCGAGGGCGACATCATGACAGTCACGATCAGCATGACGCG
CAAGAACGTCAAGGAAGGCGACACGTGCGACTTGGTGTACGCGCCACACTTCCCATATCCAAAGGTCGAGCGCTGGTTCTGCATCGTGGGCGACACGAAG
AACAACCACTTGCACGCATTTGGAAAGATCACATCGCAGGAACGCACGGCCGAGTTGAAGCTGCAGTTACAGGCGCCTCCAAAGGCTGGCACGTACCAGT
TGGAGATCTTCGTCAAGTCGGACTCGTACATTGGCTTGGACTTGCGCGCGCTTGCTAAGGTATGTGCTGTTGTTTTGTTATTTTTTGTGCTGCGCTTACT
GTCTGCGGATGTGCGCATGTTGCTAACTGTTGTACTTCTTTGCCATTCTTGTAGTTTACGGTGACACCAGCCGCGCTGCTCCCAGTGTACCAGCCCCACC
CAGAAGATTTGGAATTAGATAACGAGCCGACGCTCTTTGAACAGGTCATGAACGCTGCGGATTCGAGTGATAGTGAAGACGAGGAAGAAGACGCGGAGAG
CAAGAAGGACCAATA
	
	
ATGCTCGAGTACGACAACTCAGCGTTCTACTACTTTTCCATCTCGCTCGGCGTGCTCTATGTGGTGCCGGCCACGTACCTGTCGCTGCGCCGCATCGACC
GCCTCATCGACCGCCAGAACATCCGCTGCGACCGCGAGCTGCGCAAGATGAAGCAGCTGCAGGCCGAGAAGACCAAGTTCTCGAACGTGTTCTCGCCGCT
CTTTCTGCTCAACCTCGTTGTGCTCGCAGGTCTCTGGTACGGACTCTACCAGATGGCCATCTTACTCAAGGACGACTCGGAGATCAAGTCGTTTGACCCG
TTTGCGATCCTAGGCATCGCAGCCGGCGCCTCGGAGCGCGAGATCAAGCGCGCCTACCGCAAGATGAGTCTGATTTACCACCCAGACAAGAACATTGGCG
ATGCTGTCGCTGAACAGAAGTTTATGCTCGTTGCCAAGGCGTACGAAGCGCTGACGGATGAAGTTGCCAAGGCCAACTACGAGAAATTTGGCAACCCGGA
TGGTCGTCAGGCGCTGCAACTGTCCATTGGTCTACCGACGTTCCTATTGGACCCTGCGAACCACAACATTGTGCTCTTCTTGTACTTGATCATCTTGGTC
GTTGCGATCCCATCGTGCGTGGCGCTCTGGTACTCGCACTCGAAGAAGTATGGTGACAGCATGATCATGTACGACACGTACGGATTCTACAACTTTGCGA
TGTCGGAGCACGCGCACCCACGCATGCTGCCAGAAGTGCTCGCCGGCTCGGCGGAATTCCGTGAGATCCCAAAGCGCGCGTCGGACGACGCAGAATTGGG
TGCGCTCTTCCGTAAGTTTAAGCAGCAGGATTTGATCTCGAAGCCAAAGTACAACCATCCATCGATTGCCAAGGCGAACATCCTCATCCACGCACACTTC
TTACGTGAAAAGCTGAGTCCGGCGTTGACGGGTGACTTGCACGCGATGCTGAAGAAGGCGATCCAATTGGTGGACGGCATGCTCGAGATCTCGGTCGGCA
AGTCGTGGCTGCAGACGACGCTGAACTTGATTGAAATGGAGCAATTCCTCACGCAGGCGTTCATGCACCAGTACGTCGATATGGACCCGAAGGACCGCAA
GGGCTTGAACGACTTGAACGACGAACAGAAGGCTGAAGTCAACAAGGTGCTGGAAATGATGCCGAACGTGGAGCTCAACATCACAATCGCGGTCGACGAC
GAAGAGGAGATCGCCGAGGGCGACATCATGACAGTCACGATCAGCATGACGCGCAAGAACGTCAAGGAAGGCGACACGTGCGACTTGGTGTACGCGCCAC
ACTTCCCATATCCAAAGGTCGAGCGCTGGTTCTGCATCGTGGGCGACACGAAGAACAACCACTTGCACGCATTTGGAAAGATCACATCGCAGGAACGCAC
GGCCGAGTTGAAGCTGCAGTTACAGGCGCCTCCAAAGGCTGGCACGTACCAGTTGGAGATCTTCGTCAAGTCGGACTCGTACATTGGCTTGGACTTGCGC
GCGCTTGCTAAGTTTACGGTGACACCAGCCGCGCTGCTCCCAGTGTACCAGCCCCACCCAGAAGATTTGGAATTAGATAACGAGCCGACGCTCTTTGAAC
AGGTCATGAACGCTGCGGATTCGAGTGATAGTGAAGACGAGGAAGAAGACGCGGAGAGCAAGAAGGACCAATAG
	
	
MLEYDNSAFYYFSISLGVLYVVPATYLSLRRIDRLIDRQNIRCDRELRKMKQLQAEKTKFSNVFSPLFLLNLVVLAGLWYGLYQMAILLKDDSEIKSFDP
FAILGIAAGASEREIKRAYRKMSLIYHPDKNIGDAVAEQKFMLVAKAYEALTDEVAKANYEKFGNPDGRQALQLSIGLPTFLLDPANHNIVLFLYLIILV
VAIPSCVALWYSHSKKYGDSMIMYDTYGFYNFAMSEHAHPRMLPEVLAGSAEFREIPKRASDDAELGALFRKFKQQDLISKPKYNHPSIAKANILIHAHF
LREKLSPALTGDLHAMLKKAIQLVDGMLEISVGKSWLQTTLNLIEMEQFLTQAFMHQYVDMDPKDRKGLNDLNDEQKAEVNKVLEMMPNVELNITIAVDD
EEEIAEGDIMTVTISMTRKNVKEGDTCDLVYAPHFPYPKVERWFCIVGDTKNNHLHAFGKITSQERTAELKLQLQAPPKAGTYQLEIFVKSDSYIGLDLR
ALAKFTVTPAALLPVYQPHPEDLELDNEPTLFEQVMNAADSSDSEDEEEDAESKKDQ_