Scaffold : Scaffold_1
Gene_id : Pytul_var.sporangiiferummaker-pug3_contig_1-snap-gene-0.59
Description : T-complex protein 1 subunit zeta
ATGAGCTACCGCGGCATGAACCCGAACGCCGAGATCGTGAGCAAGTCGCAGGCGCTGCTCGTCAACGTCAGNNNNNNNNNNNNNCGCCGCCAAGGGCCTG
CAGGGTGTCCTGAAGTCCAACTTGGGTGAGCAAAGCATAGGATCTTGTTGGTTGATGCGGCAGCAACGCAAGGGGGAAGAGCTACGCTCGTTGTATTGGA
GGAGAGAAAACGCTAATGACGCTTAAATACATATGTGTAGGTCCTCGCGGTACGCTTAAGATGCTTGTCGGTGGCGCCGGCCAAATCAAGCTCACGAAGG
ACGGCAACGTGCTGCTGCACGAGATGCAGATCCAGCACCCGACGGCGGCGCTGATCGCGCGTGCCGCCACGGCCCAAGATGACATCACNNNNNNNNNNNN
NNNNNNNNNNNNNNNACGACATTTATTCATGCACTTCATTCGCCTCTCGGCTGCATGGCGTATCCATCTTCATTACTTTCATATAATGGGTTTTTATTTG
GACTGACGCTTGATGCTGATGTGCGATGATAATGCAGGGCGATGGTACCACCTCGACGGTCCTCTTCATTGGTGAATTGCTCAAGCAAGCCGAGCGTTTC
CTCGCCGACGGTTTGCACCCGCGTATCCTCGCGGAAGGCTTTGAGCTCGCCAAGGACGAGACTTTGCGCATCTTGGAGACGTTGAAGGTCGCGAACAAAG
ACATTTTGAAGGATCGCGAATTGCTCTGCTCCGTCGCGCGCACTTCGCTCCGCACCAAGCTGGACCAAAAGGCGTGTTACATGTTCTATCTTGCGTTTAT
TCGTCCATTTTGCCACAAGTATTCATCTGACATTCTATTTCGCTTGCTGTAGCTCGCGGACCAATTGACGGAAATTGTCACTGACGCTGTGCTGACGATC
GCGCAACCTGGTCGCCCAATCGACTTGCACATGATTGAAATCATGCACGTACGTACTCTAGTCTCCTTCCTTTTCTTCTCTCAGATCTGTATACGTTGGA
TTTATATGCTGAGCCTCACTGCTCTTCTTTTCTTTTTATGCATTTTCAGATGATGCACCAAAGTAGCAGTGATACCCGTTTGATCAAGGGTCTCGTGCTC
GACCACGGCTCGCGCCACCCAGACATGCCGACGTCGTTGGAGAACTGCTACATTATGACGTGCAACGTGTCGCTCGAGTACGAGAAGAGTGAAGTGAACT
CGGGTTTCTTCTACAACAGCGCCGAGCAGCGCGAAAAGATGGTTGAAGCCGAGCGCAAGTTCACGGATGACAAGGTCAAGCAGATCATTGAGCTCAAGCG
CGAGCTGTGCACGGACGAGAACAAGAAAAACTTTGTGATCGTGAACCAGAAGGGCATTGATCCGCTCTCGTTGGACATGCTCGCGAAGGAAGGCATCCTG
GCGCTGCGTCGTGCCAAGCGCCGCAACATGGAGCGTCTCACGTTGGCGTGCGGTGGTATGCCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNGCCGGCAAGGTGTACGAGCAGACGCTTGGCGAAGAGCGTTACACGTTCGTGGAAGACGTCAAGCACCCGCAATCGTG
CTCGATCTTGATCAAGGGACCAAACGAGCACACGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAACGCCATCGAAGACCAAGGTGTCGTGCCTG
GCGCGGCCGCGTTCGAGCTGGCGGCTCACGAAGCGCTGAACCAATACCGTGGCTCGGTCAAGGGCCGCGCCAAGTTGGGCGTCCAGNNNNNNNNNNNNNN
NNNNNNNNNNNGGATGCGCTGCTGGTGATCCCAAAGGTGCTGGCCGAGAACTCGGGCTTGGACGTGCAAGACACGCTGATTGCCGTGCAGGAGGAGCACG
CGAACTCGGGCGAAGCCGTCGGCATTGACTTATTCACAGGCGAACCGATGCTGCCGGCGCAGGAAGGCATCTGGGACAACTACCGCGTCAAGCGCCAGTT
CATCCACTTGGCAACCACGCTTGCGTCGCAGTTGCTGCTCGTCGACGAAGTCATGCGCGCCGGCAAGAAGATGGGCGGCGGTGGCGGCATGCAGCCCGAG
GAATAAGCGAGGGACGTTTTAGTACGTAGTAATTTTTACTTTTCTAGCGATAAATAAGGGAGCGAAAGAGAGACAAAACAAAGCATTTTCACACACACGC
ACGTATGACAAAGCGAAATAATTCTAGAAGAGTGGCAATATGCATTGCACAGAAGGGTAAATGCGGCCGAAATCTCATTATATATTGAGCGCATGATATC
TTTAACGACGACGCAGGAACAACAAATAAAACACGACGATGTCTGTGATCGCGAGCAGGATAATGATAAACCACAAAAGCACCTGTATGCACATATGCAC
AAAGGTTATCAGGTTTTTGATCCTACAACGAATGAACAGTATGCACCATGCACATACATATATGCCGTTATTCAATTACGGTGTGTACGCAACATACCTT
GCGGCGATACGATCGGTCGGCGATCTTCTTGAGCAGCGAGCGCACTTCGCCCGTGATACTCGACGTTTCGTGGAGCATGCCCTTCATATCCTGCATCTGT
GACAGCTGCAACTCCAGATCCACGAGCACGTTTCGCGCCACTTCCTCGGATTCGTACATGACGTTCTTCGTGTGCTCGATCTTGTCTGACTGGCGCAGCA
GCGTTTGCACCGACTACTCCACACATGTCAAGCAACAACACACATTATGTGAGTTCCAAGTGTTCACACCAATACATAACAGCCATCACTGTGCAGAGTA
GTTCGCAACGATCGTTATGTATCATCCAGAAATCGCTGTACAAGACGAGCGGAGCTGTTAAATGAGGACGCGCCATTGCCATTCACACATACACACACAC
CTGGTCATTGGAGAACGTGCTGTAGTTGTTCATGTTCGGGTTCGCGTCAGGGCCAGGATATTTGCTGCCTGCGGACGTGGGGCTCCGGTTCTTCAGGTTG
CGTCCATTGACGTTTCCATTGACATTGGCATTGGCATTGCTGCCCGTGTCGCTCAGGTGGAGATCGCGGAAGCTGCCGTGCATCCTGGCGCTCGGATCTT
CTTCGCTCTCTTGTTGCGTCCTTTTTTCCGCTTGAGCCACTTGGCGCTGGTCGACCCTCCACGAAAAAAGAATGAATCAGGAATCCACACATAAGGGGTC
CACATTATTTAGATTCATATTAACTATAGTGCGCCACACTATTTTAGAGACTGCATGAATGGAAAGAGCGCACATAGTGCGGTGAGATGAGCTTCGGGAA
GACCAACTACCGCTCTGGTGGCACGCGCGGCGGCGCCGATCGTACGTGCTGAGCAGCGCTGCGTCACATTTAGATGATGCCGCTTATGCTATTACGTACC
TGTGTTAACGCTTTGTGTGTTATATCGCTATGTGTGCTTATTTTTTCTGTGCTGGAACAGAGTTCAAGTGGGAGGATGTGAAGAATGATAAATACCGTGA
AAACTATCTGGGGCATTCGCTGCAAGCGCCTGTGGGACGATGGCAAAAAGGTATGACTGCATGCATGCTATTGCATACTTAATTTGTATGCTGTTGAACT
ATAGCTAAGCGTGTTCTTATTGATTATGGCCTGCGGTAGGGAAGGATTTGACGTGGTATGCGAAGACGAGCAAAGAGCAGCGCGCGTTGGAGTTAAAGCA
GGAAATCCTGCTGGCCAAGCAACGCGACGAAGATCTGATGAATGAAGCACTGTACGTGATGTGCATGCCATTATTGCCCGCAATAATGATGGATGTTGCG
TGGGTACCCATTGTTGCTACTGCTGTGTTGTTGCATTGTAGGGGTCTTGCACCACGTCGCCGTCACGAGCCGACGGAGCAATTGGATGCTTCCGAGATGA
AAGAACTGCTGAAACGCGGTGAGTCGGAGCGCGATGGCATGGATACTGAGCGTGTAGAAGGTCTCGGAGCTGCTCCTGTGATCACTGGAGTCGAAACCGG
TCCGAAGAAGACGCTCGCGGAGCGATACAGGGAAACGCTGGAATCGGGGAAGCAGGATACAACGTTTGCGCTGCCTGGAACAATTGATGTGTCAAACGCA
AATGGGAACGCAGTGCACGAGAAAGGATCGAAAGAAGAGAGGAAAGCGAGAAAAGCAGCAAAGAAGCAGCAACGGAAGGAGGAGAAGAAAGCCAAGAAGG
AGCGCAAGAAGGAGCGGAAGGAGAAGAGGCACTCCAGCGCATCGCTCTCGCACCGTTCGAGTCGAAAGTACAGCAGTGACGACGATGAGCGAAAAAGTAC
TGCCGATCGGAGAAACGATCGCTCGAGATCGCGCTCTCGCGGCCGCAAGACTGAAGTCTCTCGGTCTGCTTCACGGTCGCCGTCGAGAGGAAAGTCGTCT
CGCCAGCGCTCGCGTTCGCGCTCGAAGGATCGAGGTAGAGACCGAGTTTTCGACGCGCGCGGATCTACGCGCCGCGCGCCGCGTTCGCGCTCTCGCTCTC
CACGCGCTGTTCATGCGTCGTCGTCGAGTCGACGCCGTGAGCGCTCACGCTCGTACTCTCCAGAGAGTCGATATGATCGGAGATACGAAAGACGCCGCTC
TCGATCCAGATCCAGGTCGGCACGCAGGGATTAGATGCAGAGAGCGGAGATGTCGCGGACGGCGAATGGCGTCGATACCAAGTATGTTCTTTTTTTCCTC
TCTCTTTTATACCCGTAAAGATACAATTGCCTTTCTTGCACCAAGAGCGTCTGCGTTCTTTGTATATTTTCTAGTCTTCTATGTGTATGTGCTGTACTGA
CTGATATTGTGCTGCTTTCCTGAAGCTTCGTCCTTGGCTTCGTCTTAGTCGGACTTGGAGGACGTATGCGCTTTCTTCTGCCGCCCACAGCGTTCCGAGT
TCCCGTCTTTGAGCTCGTA
	
	
ATGAGCTACCGCGGCATGAACCCGAACGCCGAGATCGTGAGCAAGTCGCAGGCGCTGCTCGTCAACATGCTTGTCGGTGGCGCCGGCCAAATCAAGCTCA
CGAAGGACGGCAACGGCGATGGTACCACCTCGACGGTCCTCTTCATTGGTGAATTGCTCAAGCAAGCCGAGCGTTTCCTCGCCGACGGTTTGCACCCGCG
TATCCTCGCGGAAGGCTTTGAGCTCGCCAAGGACGAGACTTTGCGCATCTTGGAGACGTTGAAGGTCGCGAACAAAGACATTTTGAAGGATCGCGAATTG
CTCTGCTCCCTCGCGGACCAATTGACGGAAATTGTCACTGACGCTGTGCTGACGATCGCGCAACCTGGTCGCCCAATCGACTTGCACATGATTGAAATCA
TGCACATGATGCACCAAAGTAGCAGTGATACCCGTTTGATCAAGGGTCTCGTGCTCGACCACGGCTCGCGCCACCCAGACATGCCGACGTCGTTGGAGAA
CTGCTACATTATGACGTGCAACGTGTCGCTCGAGTACGAGAAGAGTGAAGTGAACTCGGGTTTCTTCTACAACAGCGCCGAGCAGCGCGAAAAGATGGTT
GAAGCCGAGCGCAAGTTCACGGATGACAAGGTCAAGCAGATCATTGAGCTCAAGCGCGAGCTGTGCACGGACGAGAACAAGAAAAACTTTGTGATCGTGA
ACCAGAAGGGCATTGATCCGCTCTCGTTGGACATGCTCGCGAAGGAAGGCATCCTGGCGCTGCGTCGTGCCAAGCGCCGCAACATGGAGCGTCTCACGTT
GGCGTGCGGTGAGTTCAAGTGGGAGGATGTGAAGAATGATAAATACCGTGAAAACTATCTGGGGCATTCGCTGCAAGCGCCTGTGGGACGATGGCAAAAA
GGGAAGGATTTGACGTGGTATGCGAAGACGAGCAAAGAGCAGCGCGCGTTGGAGTTAAAGCAGGAAATCCTGCTGGCCAAGCAACGCGACGAAGATCTGA
TGAATGAAGCACTGGGTCTTGCACCACGTCGCCGTCACGAGCCGACGGAGCAATTGGATGCTTCCGAGATGAAAGAACTGCTGAAACGCGGTGAGTCGGA
GCGCGATGGCATGGATACTGAGCGTGTAGAAGGTCTCGGAGCTGCTCCTGTGATCACTGGAGTCGAAACCGGTCCGAAGAAGACGCTCGCGGAGCGATAC
AGGGAAACGCTGGAATCGGGGAAGCAGGATACAACGTTTGCGCTGCCTGGAACAATTGATGTGTCAAACGCAAATGGGAACGCAGTGCACGAGAAAGGAT
CGAAAGAAGAGAGGAAAGCGAGAAAAGCAGCAAAGAAGCAGCAACGGAAGGAGGAGAAGAAAGCCAAGAAGGAGCGCAAGAAGGAGCGGAAGGAGAAGAG
GCACTCCAGCGCATCGCTCTCGCACCGTTCGAGTCGAAAGTACAGCAGTGACGACGATGAGCGAAAAAGTACTGCCGATCGGAGAAACGATCGCTCGAGA
TCGCGCTCTCGCGGCCGCAAGACTGAAGTCTCTCGGTCTGCTTCACGGTCGCCGTCGAGAGGAAAGTCGTCTCGCCAGCGCTCGCGTTCGCGCTCGAAGG
ATCGAGAGACCGAGTTTTCGACGCGCGCGGATCTACGCGCCGCGCGCCGCGTTCGCGCTCTCGCTCTCCACGCGCTGTTCATGCGTCGTCGTCGAGTCGA
CGCCATACGAAAGACGCCGCTCTCGATCCAGATCCAGGTCGGCACGCAGGGATTAGATGCAGAGAGCGGAGATGTCGCGGACGGCGAATGGCGTCGATAC
CAACGTTCCGAGTTCCCGTCTTTGAGCTCGTAA
	
	
MSYRGMNPNAEIVSKSQALLVNMLVGGAGQIKLTKDGNGDGTTSTVLFIGELLKQAERFLADGLHPRILAEGFELAKDETLRILETLKVANKDILKDREL
LCSLADQLTEIVTDAVLTIAQPGRPIDLHMIEIMHMMHQSSSDTRLIKGLVLDHGSRHPDMPTSLENCYIMTCNVSLEYEKSEVNSGFFYNSAEQREKMV
EAERKFTDDKVKQIIELKRELCTDENKKNFVIVNQKGIDPLSLDMLAKEGILALRRAKRRNMERLTLACGEFKWEDVKNDKYRENYLGHSLQAPVGRWQK
GKDLTWYAKTSKEQRALELKQEILLAKQRDEDLMNEALGLAPRRRHEPTEQLDASEMKELLKRGESERDGMDTERVEGLGAAPVITGVETGPKKTLAERY
RETLESGKQDTTFALPGTIDVSNANGNAVHEKGSKEERKARKAAKKQQRKEEKKAKKERKKERKEKRHSSASLSHRSSRKYSSDDDERKSTADRRNDRSR
SRSRGRKTEVSRSASRSPSRGKSSRQRSRSRSKDRETEFSTRADLRAARRVRALALHALFMRRRRVDAIRKTPLSIQIQVGTQGLDAESGDVADGEWRRY
QRSEFPSLSS_