Scaffold : Scaffold_1
Gene_id : Pytul_var.sporangiiferummaker-pug3_contig_1-fgenesh-gene-1.2
Description : Mitochondrial ribosomal protein L51/S25/CI-B8 family protein
TCGCAGCAGCATCCGCAAGACGCAACCGAGTCCGCAGCAAAGATGGCGACGAAGGGAGTGTGGCAGCTGAAGGAGGTGACAATCCGTTACTGCCAGCACG
GCGGAAGCAGCCGCTACATTAGGTACGTTGATGGGGGATATGTGTGTGTGCTATTGTTGTTGCATGCGGTGCGCTCTACGTGCGCCATGACGGCTCTACG
TAGCTATCGATCGACTGTGCCAACCACGCGTTTGTATTGACAGCATGCATAATCAAATGCTTATAAACGATATTTTTTTGCTGTAGACAAATGCTCGGTG
ATGAGCGTTTCCTGAACTTCGTCAAGGAGAACCCTCAAGTGAAGTTTCAGACCGAATTGAAGGGCGCTCGCCACCCAGTCCTCATCGGCGATTACAGTGA
GTACCTAATGAAAATTTACCGCATTTGGCGCTACTGATCGCTAACATGTCCGCTGTATCTGTTATTTGTAGTCACCAACGACCGCAAGGTCTGCGATGTG
AAGAATCAGGACATTGACTTCGTCATGATGCAGGTACGCTATGCATTTCAGAAATGCTTTATTGCATGCATGAATGCGATGCTGACGATTTTATACGCGC
TGCTGTTTGTAGTTGGAGCGTATGAGAAACTCGAGCGGCCGAAAGATGACTGCGATGAAGAAGCCTGTGATCTCGAAGCGACCAACGATCCAAGGCATCT
GGCAGCCAGACCTTGAGTTCCCAGACTTCAAAATCGAGCACCGTAGTTAAGTGCTGAAGCAGGGAATGGCGATGCCGTTGTGCATACCACGTTGTTTTCA
TGATAAAAAAAAAAGAGAGATTCTGGATTCCTTTCAGACATTAGATCAACGGCTCTTGTTTGATATCGCTGAGACCATGTGTGTTCCTCCAAC
	
	
ATGGCGACGAAGGGAGTGTGGCAGCTGAAGGAGGTGACAATCCGTTACTGCCAGCACGGCGGAAGCAGCCGCTACATTAGACAAATGCTCGGTGATGAGC
GTTTCCTGAACTTCGTCAAGGAGAACCCTCAAGTGAAGTTTCAGACCGAATTGAAGGGCGCTCGCCACCCAGTCCTCATCGGCGATTACATCACCAACGA
CCGCAAGGTCTGCGATGTGAAGAATCAGGACATTGACTTCGTCATGATGCAGTTGGAGCGTATGAGAAACTCGAGCGGCCGAAAGATGACTGCGATGAAG
AAGCCTGTGATCTCGAAGCGACCAACGATCCAAGGCATCTGGCAGCCAGACCTTGAGTTCCCAGACTTCAAAATCGAGCACCGTAGTTAA
	
	
MATKGVWQLKEVTIRYCQHGGSSRYIRQMLGDERFLNFVKENPQVKFQTELKGARHPVLIGDYITNDRKVCDVKNQDIDFVMMQLERMRNSSGRKMTAMK
KPVISKRPTIQGIWQPDLEFPDFKIEHRS_