Scaffold : Scaffold_1
Gene_id : Pytul_var.sporangiiferumsnap-pug3_contig_1-abinit-gene-0.167
Description : Protein kinase
ATGGCGAGCGCGGGCGGGACCAATGGCATCTACATTGGGCACTGCATCGTGCAATGCATTTTCTCACTGACCACGGTGGCGATCCTGCTCTCATTGCGCG
CCGACACGAGGTACTGGCTCGGCATTGACGACGGCACGTCGCGCACGCGGAATCCGATGCGGCAGTACATGCGCCAGCTTGCGGAGCGCGGCATGATCAC
GAATTTCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGTGTACGACGTCCACCGCATGATCGAAGAGCACAGGAAGAATGTCGTGGATTTCTCCGAGC
TGAAGCTCGATGGCATCATCGCGCAGGGCGCAACATCGATCGTCATGCGCGGCGTTCTGCGAGGGAACACCGACATCGCACTCAAGATCTACACGTCCGT
CCAGGTCACCGACGAAGAACTGGATCGTTTTTCCCGAGAAACAGCGCTGAACGTGCAGCTTTCGCACCCGAATATCGTCAAATTCCACGGTCTTTGCGTC
GTGCCGCCCTCGATCTCGCTCGTATTTGAGTTTTGCGAGTACGGCGGACTCGATATCGCGCTGCAAAACAGTCGTTTCTGGGGGCTCTCGACGAAACTCA
AGGCGTGGCTGGATGCGTGCAAGGCCGTCGCGTACCTGCACAGCTTTTCGCCGCCCTTGCTGCATCGCGACATCAAGACCGACAATTTCCTACTGGGCCA
AGATTACCTGCTCAAGCTGGCGGATTTCGGCGAAGCAAACTTGTTGCGGCCACGCACGGACGGGACGATGACGATCGCCGGGACAGTGGATTACATGGCG
CCAGAGATGATCCTCGGTGGGAAAACGGCGCGATATGGGACTGCCGTGGACACCTACAGTCTGATGATCACGCTCTGGCAGATCATGGTGCCCGACCGGA
GCCCGTGGGAGGGGAAGACGCATCTTGAGGTGTATACGTGCGTCAAGGATGGCGAGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCAGGGG
TGCGCCGAGATCCTCGAGAGCGGCTGGTGCGCAAACCCGTTCGAACGCGTGGCGGTCGATGAACTCATCCCGAAGGTTCACAAACTGTGGCTGCTCTCGC
TCCATCAGAAAGTACTCAAGCGCACAAAGTGAGAACCAATTTTATTATGTTCCTGTTTTTTTAGCTGTTGCCTGGAAACACGCACCCAGTA
	
	
ATGGCGAGCGCGGGCGGGACCAATGGCATCTACATTGGGCACTGCATCGTGCAATGCATTTTCTCACTGACCACGGTGGCGATCCTGCTCTCATTGCGCG
CCGACACGAGGTACTGGCTCGGCATTGACGACGGCACGTCGCGCACGCGGAATCCGATGCGGCAGAAGAATGTCGTGGATTTCTCCGAGCTGAAGCTCGA
TGGCATCATCGCGCAGGGCGCAACATCGATCGTCATGCGCGGCGTTCTGCGAGGGAACACCGACATCGCACTCAAGATCTACACGTCCGTCCAGGTCACC
GACGAAGAACTGGATCGTTTTTCCCGAGAAACAGCGCTGAACGTGCAGCTTTCGCACCCGAATATCGTCAAATTCCACGGTCTTTGCGTCGTGCCGCCCT
CGATCTCGCTCGTATTTGAGTTTTGCGAGTACGGCGGACTCGATATCGCGCTGCAAAACAGTCGTTTCTGGGGGCTCTCGACGAAACTCAAGGCGTGGCT
GGATGCGTGCAAGGCCGTCGCGTACCTGCACAGCTTTTCGCCGCCCTTGCTGCATCGCGACATCAAGACCGACAATTTCCTACTGGGCCAAGATTACCTG
CTCAAGCTGGCGGATTTCGGCGAAGCAAACTTGTTGCGGCCACGCACGGACGGGACGATGACGATCGCCGGGACAGTGGATTACATGGCGCCAGAGATGA
TCCTCGGTGGGAAAACGGCGCGATATGGGACTGCCGTGGACACCTACAGTCTGATGATCACGCTCTGGCAGATCATGGTGCCCGACCGGAGCCCGTGGGA
GGGGAAGACGCATCTTGAGGTGTATACCTGTTGCCTGGAAACACGCACCCAGTAA
	
	
MASAGGTNGIYIGHCIVQCIFSLTTVAILLSLRADTRYWLGIDDGTSRTRNPMRQKNVVDFSELKLDGIIAQGATSIVMRGVLRGNTDIALKIYTSVQVT
DEELDRFSRETALNVQLSHPNIVKFHGLCVVPPSISLVFEFCEYGGLDIALQNSRFWGLSTKLKAWLDACKAVAYLHSFSPPLLHRDIKTDNFLLGQDYL
LKLADFGEANLLRPRTDGTMTIAGTVDYMAPEMILGGKTARYGTAVDTYSLMITLWQIMVPDRSPWEGKTHLEVYTCCLETRTQ_