Scaffold : Scaffold_1
Gene_id : Pytul_var.sporangiiferummaker-pug3_contig_1-snap-gene-0.57
Description : Pc18g01730 protein
ATGGCGCAAGAAGAAGCAGCAACGCAGCAAGAGCAGCGCGGCGGCGCGCGTTCGCACGCGTTTCTCCCGCGTCATATCATCGTGCTCGTGCACGGCAANN
NNNNNNNNNNNNNNNNNNNNNNNNNNGGATTTCGACGCCATCGAGAGCGCGCTCGTCAAGAAATATGGCTTCGACGACATCTTGATCATCAAATCCAAGG
TCAACCACACGCAGACGTCGCTGGGCGTCGAGGTCNNNNNNNNNNGCTCGCCAGCGAGGTGTACCAGGAGGTGTTCCAGCACGAGTTGCACCCCGATATC
AACTCGTACAAGTTCTCGATCATTGCGCACTCGCTCGGCGGGCTCTACGCGCGCTTTGCGCTCGTGCAGCTCATGGAATCGCTCAGTCCGCTGGATATCC
AGTACGTCAGCTTCGTCACGATCTGCACCCCGCATCTCGGCTCTCGGCGGCCTCGAGGCGACTCGACGCTCAAAGTATAGTACTCTTTCTGTGCTTGTAG
TTCTTCAAGAAGGCTGTGTTGTTGATACAGTATTTTATGATGAAAATGATAGAATGTGTGGCGGATGGGCGTTCATACCGTGCTNNNNNNNNNNNNNNNN
NNNNNNNNNNNGCGACGAATGCGCTGTATGGGCGAACGGGGGTGGACCTCCTCATTGATAGCAGCAGTGATGATGACAATGGATCGCCGGTGCCTCCGGT
TCTGGAGGTCATGACCAACCCAGGTAAGATGCATGTATAAACGAGGAGACTGTGTCTTTCACTGTTGAGGCTGTACTTATATGTGTGCCGTTGTGTAGAG
TTTGAGTATTTGAACGCATTGAAGCGATTTCGCTCTGGTACGCTGGTGGCCATGACGGATGGCGACATGCTCGTGCCGTACGCGTCTGCGTCGATCCGGA
ATTTCAATCCATACCCGAGTGCGATGTTAACCGACAAGTTCACGGAATGGCGATGGCATGTGCACCATTCTGGCTTCACGNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNTCCATTTTGGCGAAAATTGGGCAGCAGAGTGGACCTCGCGACCATAACGATCGAGAAATTGCATGTTGGCGTCG
ACGTGAGTACATGCGAACGGTTTCAAAGTGTCGAAGGCTACGACGCAGACAACAAACAGGAGGTCGAGTTCCCGTATGCGATGATCCAGAGGCTGCAGCA
GGCAATCCCGTGGCGTCGCATCGATGTGACCGTCGAGCCATGCGGCGTGAAAGGCAAGTTCCGCATCCATGACTGGCCGATCAACAAGATGCAGCCTCCT
GGCTGCCGCGCCGACGAATTCATCGACCTCTTGTGCGAGATGGTTGGACATGATCACGAGCTGGAGCCGCTCCCAGAAGCCAATGAAGACCAGCGCTCGT
CATCGAGTGCAACTCCGGTGGACAGCTCCGACGATGATACTGCGCCACGAAATCCGTTTGGTGGTCCCATGATCAATCGCTTTTTGGAGAAATTCCAGAA
AACGACACCGCCAGATAATCAAGTGTTGTCGCCTGCATCGGCTGAGAGCTCGAACGTCGATGACGAAAACCAGCAACAGCCTCGGAATTCGTTCTTTGGC
AATGGGATGAACCGCATGCGCGAGAAGTTCCAAAAGAAACAAGATGCAGGATCTCAATATGATGGCGCCCAGCCATCGCCATCGACCAGCAGCGGCGTGG
CGAGCAAGTCAATGGAGACGGAGAGTGAAAATACCGGCAGGAGTTCGTTCGGCGCCATGGGAATGCGGTTCATGGAGAAATTCACGAAAAAGGAGACGCC
TTCGCCAGCCCCGACGACAGCCGGCACCCCAACAGTGTCTTCTTCCACGACCACTTCGACCGA
	
	
ATGGCGCAAGAAGAAGCAGCAACGCAGCAAGAGCAGCGCGGCGGCGCGCGTTCGCACGCGTTTCTCCCGCGTCATATCATCGTGCTCAGCGCGCTCGTCA
AGAAATATGGCTTCGACGACATCTTGATCATCAAATCCAAGGTCAACCACACGCAGACGTCGCTGGGCGTCGAGGAGGTGTTCCAGCACGAGTTGCACCC
CGATATCAACTCGTACAAGTTCTCGATCATTGCGCACTCGCTCGGCGGGCTCTACGCGCGCTTTGCGCTCGTGCAGCTCATGGAATCGCTCAGTCCGCTG
GATATCCAGTACGTCAGCTTCGTCACGATCTGCACCCCGCATCTCGGCTCTCGGCGGCCTCGAGGCGACTCGACGCTCAAAGTATACAGTGATGATGACA
ATGGATCGCCGGTGCCTCCGGTTCTGGAGGTCATGACCAACCCAGAGTTTGAGTATTTGAACGCATTGAAGCGATTTCGCTCTGGTACGCTGGTGGCCAT
GACGGATGGCGACATGCTCGTGCCGTACGCGTCTGCGTCGATCCGGAATTTCAATCCATACCCGAGTGCGATGTTAACCGACAAAGTGGACCTCGCGACC
ATAACGATCGAGAAATTGCATGTTGGCGTCGACGTGAGTACATGCGAACGGTTTCAAAGTGTCGAAGGCTACGACGCAGACAACAAACAGGAGGTCGAGT
TCCCGTATGCGATGATCCAGAGGCTGCAGCAGGCAATCCCGTGGCGTCGCATCGATGTGACCGTCGAGCCATGCGGCGTGAAAGGCAAGTTCCGCATCCA
TGACTGGCCGATCAACAAGATGCAGCCTCCTGGCTGCCGCGCCGACGAATTCATCGACCTCTTGTGCGAGATGGTTGGACATGATCACGAGCTGGAGCCG
CTCCCAGAAGCCAATGAAGACCAGCGCTCGTCATCGAGTGCAACTCCGGTGGACAGCTCCGACGATGATACTGCGCCACGAAATCCGTTTGGTGGTCCCA
TGATCAATCGCTTTTTGGAGAAATTCCAGAAAACGACACCGCCAGATAATCAAGTGTTGTCGCCTGCATCGGCTGAGAGCTCGAACGTCGATGACGAAAA
CCAGCAACAGCCTCGGAATTCGTTCTTTGGCAATGGGATGAACCGCATGCGCGAGAAGTTCCAAAAGAAACAAGATGCAGGATCTCAATATGATGGCGCC
CAGCCATCGCCATCGACCAGCAGCGGCGTGGCGAGCAAGTCAATGGAGACGGAGAGTGAAAATACCGGCAGGAGTTCGTTCGGCGCCATGGGAATGCGGT
TCATGGAGAAATTCACGAAAAAGGAGACGCCTTCGCCAGCCCCGACGACAGCCGGCACCCCAACAGTGTCTTCTTCCACGACCACTTCGACCGAT
	
	
MAQEEAATQQEQRGGARSHAFLPRHIIVLSALVKKYGFDDILIIKSKVNHTQTSLGVEEVFQHELHPDINSYKFSIIAHSLGGLYARFALVQLMESLSPL
DIQYVSFVTICTPHLGSRRPRGDSTLKVYSDDDNGSPVPPVLEVMTNPEFEYLNALKRFRSGTLVAMTDGDMLVPYASASIRNFNPYPSAMLTDKVDLAT
ITIEKLHVGVDVSTCERFQSVEGYDADNKQEVEFPYAMIQRLQQAIPWRRIDVTVEPCGVKGKFRIHDWPINKMQPPGCRADEFIDLLCEMVGHDHELEP
LPEANEDQRSSSSATPVDSSDDDTAPRNPFGGPMINRFLEKFQKTTPPDNQVLSPASAESSNVDDENQQQPRNSFFGNGMNRMREKFQKKQDAGSQYDGA
QPSPSTSSGVASKSMETESENTGRSSFGAMGMRFMEKFTKKETPSPAPTTAGTPTVSSSTTTSTD