Scaffold : Scaffold_1
Gene_id : Pytul_var.sporangiiferummaker-pug3_contig_1-snap-gene-1.14
Description : Phosphatidylinositol kinase (PIK-L4)
ATGCCAACATCGCTCAAGTATCGTGACCCGATTCTAGCGCTGCGTCGTGTTCTGCTGCAGGAAGCGAATCTACGGAACGAAGTTTCACATTATTGGCTCC
TACAAGCGAAGCTTGCTCGGAAAGAAGGGTACGCTCGCACGGCATCGAGCGCAGTGATGCATGCAGAAGCACTAGATAACCAGTACGCTCTTCTTGAGAA
GGCAAAGCTGATGGTGAGCCAAGACCGAATGTACGAAGCGCTTCAACTTCTCGAGCCAGTTGATATCGACGCGTCCAAGCTAGATTTTGACGTGGAAGAT
CCGCACTTTTGCGCGAAAAATCTTCTCCTAGCTACAAACTGGATGCAAGAATCTGGCCAGCGGCAAGGTAAAAAAGTTATCGAGCGATACCAAGCTGTGA
TCCAGTTTGATCCGAAGTGGGAAAAAGGCTACTTCTTCTTAGCAAAGTACTACGAGTACCTGCTTAGTGTCAGTCACCCGGAGGCAACCGCATCAATGGG
CGAAGGAGGCTCAATCCTACTGGATTCCGTATTTCATTCGCATCTGATCAACTTGATGAAGAACTATGTTCTAGCGTTGCGACATGGGACGAAATTTGTA
TTTCAGTCGCTACCTCGACTACTCACTTTGTGGTTTGAATACGGCGAACTCCTGTATGCAAGCAATTCGGGAGCGAAAGCGAGCAAGGCGAACAAGACTC
TTCGACATATCGAAATTGGCCTCAGCCAGTCAAGTACAGAGCAGCAGATTCTGACTGATATCACACAAGTTATTCATGATGCAGCAGATACATTGCCTGC
GTACGAATGGCTGGTTTGCTTTCCCCAAGTGACATCTCGAATTTGCCACCCGAATCCTGTCGTCGTGGATGGAGTCAAGAAGATCATGGTGAAGGTTTTG
GGAGCGTATCCTACTCAAGCGATGTGGCCGCTTCTCGGGCTTTCCCGCTCTATCAACAACCAGCGTCGCACTCGAGCCCGTGATATCATCTCAAACATCC
AGCGTCAATTCGTGTCAATTGGCCAGCAAGAGATTGCGAATAGCTTCTCGGAGGGAATGCGGTTGGTAGAAGAGCTCATCAGTCTCGCCGGTCATGACCC
AGCAAATCAGCGGAAGATCCACATTCGTTTGAGTCGAATTCGAAGTAAAATTCTAGTTCCTGTGCAAGCTGCACTCACGACGGTTCTGCCTGCATCAGGC
TTGGCCCCACGTGACGACCAACACAGCGCATTTTCTCCTCAAGCCCAAATCCATATCAAAGCATTTAGCGACAAGGCGGACGTGATGATGACAAAGGAAA
AGCCCAAGCGGATTGAGGTTCTTGGAAGTGACGGTCGCTTGTATCCGTTCCTTTGCAAACGCGAGAAGACTGGCGATTTGCGCAAGGACGCGCGGATGAT
GGAGTTCAATACGATGATCAACAAGCTTTTACAAAAAGACGGCGAGGGACGCAAGCGAAAACTGCGATTGCGCACGTATGCAGTGGTGTGTTTGAACGAA
GAGAGCGGGCTCATGGAGTGGGTGCGCAATACAAAGGCGATGCGTCAGCTGATCGGCCAGATTCACAAGACGGAGCGTGGATTCATTCAACCGGTGCGGC
TAACGCACGAGATCAAAGAGCGCTTCTTGACGATGCAGAAAAAGTACGCCGACAATGTGCCCAAGATGGCGGCGTATTATCGACGCAACGTCTTGTCGTT
GCCTGTGTTTACGCCAAGGTTCCACCAGTGGTTTTGCAACAATTTCGTAGACCCGACAGCGTGGTTTGAGTCTCGCCTGACGTTTTCTCGCTCAGCAGCA
GTGTGGTCGATGGTTGGTCATATCATTGGCCTCGGTGATCGCCATGGCGAAAACATCCTTATTGATTGCACGAATGGCGAGTGTGTCCACGTGGATTTCG
ACTGCTTGTTTGATAAAGGACTGAAACTCGCAAAGCCTGAGATTGTTCCGTTCCGACTCACCCCCAACATGATTGACGCGTTTGGAATCACGGGGTATGA
AGGTGTGTTCCGTCGCGTTTGCGAAGTCACGATGCACTTGCTACGTGGGAACAAGGAAACCCTGCGAAGCGTGCTCGAATCGTTCATTCACGACCCACTG
GTCGAGTGGGGCCGCAAAGGCAAGGCGACTCAAAGTGCCGCTGGAGCGCCGTCTGCTGCTCGGAGCATCGCAGATATCTCGAATGACCGCAGCAAAGAGG
AGACCCGGATTATCTTGAAGACCATTGACGATCGTCTGCGCGGGATCTACAACTTGGGCGACGCGATTCGACCGCACGTCTCGTCGTCGCATCGCAGCAT
TTTGCCCGAGAACGAGACGCTGCCGCTGTCTGTCCAGGGCCAAGTCGACAAATTGATCCACGAAGCAACGTCCCACGAAAACCTTGCACAGATGTACATT
GGGTGGATGCCATTTTTGTA
	
	
ATGCCAACATCGCTCAAGTATCGTGACCCGATTCTAGCGCTGCGTCGTGTTCTGCTGCAGGAAGCGAATCTACGGAACGAAGTTTCACATTATTGGCTCC
TACAAGCGAAGCTTGCTCGGAAAGAAGGGTACGCTCGCACGGCATCGAGCGCAGTGATGCATGCAGAAGCACTAGATAACCAGTACGCTCTTCTTGAGAA
GGCAAAGCTGATGGTGAGCCAAGACCGAATGTACGAAGCGCTTCAACTTCTCGAGCCAGTTGATATCGACGCGTCCAAGCTAGATTTTGACGTGGAAGAT
CCGCACTTTTGCGCGAAAAATCTTCTCCTAGCTACAAACTGGATGCAAGAATCTGGCCAGCGGCAAGGTAAAAAAGTTATCGAGCGATACCAAGCTGTGA
TCCAGTTTGATCCGAAGTGGGAAAAAGGCTACTTCTTCTTAGCAAAGTACTACGAGTACCTGCTTAGTGTCAGTCACCCGGAGGCAACCGCATCAATGGG
CGAAGGAGGCTCAATCCTACTGGATTCCGTATTTCATTCGCATCTGATCAACTTGATGAAGAACTATGTTCTAGCGTTGCGACATGGGACGAAATTTGTA
TTTCAGTCGCTACCTCGACTACTCACTTTGTGGTTTGAATACGGCGAACTCCTGTATGCAAGCAATTCGGGAGCGAAAGCGAGCAAGGCGAACAAGACTC
TTCGACATATCGAAATTGGCCTCAGCCAGTCAAGTACAGAGCAGCAGATTCTGACTGATATCACACAAGTTATTCATGATGCAGCAGATACATTGCCTGC
GTACGAATGGCTGGTTTGCTTTCCCCAAGTGACATCTCGAATTTGCCACCCGAATCCTGTCGTCGTGGATGGAGTCAAGAAGATCATGGTGAAGGTTTTG
GGAGCGTATCCTACTCAAGCGATGTGGCCGCTTCTCGGGCTTTCCCGCTCTATCAACAACCAGCGTCGCACTCGAGCCCGTGATATCATCTCAAACATCC
AGCGTCAATTCGTGTCAATTGGCCAGCAAGAGATTGCGAATAGCTTCTCGGAGGGAATGCGGTTGGTAGAAGAGCTCATCAGTCTCGCCGGTCATGACCC
AGCAAATCAGCGGAAGATCCACATTCGTTTGAGTCGAATTCGAAGTAAAATTCTAGTTCCTGTGCAAGCTGCACTCACGACGGTTCTGCCTGCATCAGGC
TTGGCCCCACGTGACGACCAACACAGCGCATTTTCTCCTCAAGCCCAAATCCATATCAAAGCATTTAGCGACAAGGCGGACGTGATGATGACAAAGGAAA
AGCCCAAGCGGATTGAGGTTCTTGGAAGTGACGGTCGCTTGTATCCGTTCCTTTGCAAACGCGAGAAGACTGGCGATTTGCGCAAGGACGCGCGGATGAT
GGAGTTCAATACGATGATCAACAAGCTTTTACAAAAAGACGGCGAGGGACGCAAGCGAAAACTGCGATTGCGCACGTATGCAGTGGTGTGTTTGAACGAA
GAGAGCGGGCTCATGGAGTGGGTGCGCAATACAAAGGCGATGCGTCAGCTGATCGGCCAGATTCACAAGACGGAGCGTGGATTCATTCAACCGGTGCGGC
TAACGCACGAGATCAAAGAGCGCTTCTTGACGATGCAGAAAAAGTACGCCGACAATGTGCCCAAGATGGCGGCGTATTATCGACGCAACGTCTTGTCGTT
GCCTGTGTTTACGCCAAGGTTCCACCAGTGGTTTTGCAACAATTTCGTAGACCCGACAGCGTGGTTTGAGTCTCGCCTGACGTTTTCTCGCTCAGCAGCA
GTGTGGTCGATGGTTGGTCATATCATTGGCCTCGGTGATCGCCATGGCGAAAACATCCTTATTGATTGCACGAATGGCGAGTGTGTCCACGTGGATTTCG
ACTGCTTGTTTGATAAAGGACTGAAACTCGCAAAGCCTGAGATTGTTCCGTTCCGACTCACCCCCAACATGATTGACGCGTTTGGAATCACGGGGTATGA
AGGTGTGTTCCGTCGCGTTTGCGAAGTCACGATGCACTTGCTACGTGGGAACAAGGAAACCCTGCGAAGCGTGCTCGAATCGTTCATTCACGACCCACTG
GTCGAGTGGGGCCGCAAAGGCAAGGCGACTCAAAGTGCCGCTGGAGCGCCGTCTGCTGCTCGGAGCATCGCAGATATCTCGAATGACCGCAGCAAAGAGG
AGACCCGGATTATCTTGAAGACCATTGACGATCGTCTGCGCGGGATCTACAACTTGGGCGACGCGATTCGACCGCACGTCTCGTCGTCGCATCGCAGCAT
TTTGCCCGAGAACGAGACGCTGCCGCTGTCTGTCCAGGGCCAAGTCGACAAATTGATCCACGAAGCAACGTCCCACGAAAACCTTGCACAGATGTACATT
GGGTGGATGCCATTTTTGTAG
	
	
MPTSLKYRDPILALRRVLLQEANLRNEVSHYWLLQAKLARKEGYARTASSAVMHAEALDNQYALLEKAKLMVSQDRMYEALQLLEPVDIDASKLDFDVED
PHFCAKNLLLATNWMQESGQRQGKKVIERYQAVIQFDPKWEKGYFFLAKYYEYLLSVSHPEATASMGEGGSILLDSVFHSHLINLMKNYVLALRHGTKFV
FQSLPRLLTLWFEYGELLYASNSGAKASKANKTLRHIEIGLSQSSTEQQILTDITQVIHDAADTLPAYEWLVCFPQVTSRICHPNPVVVDGVKKIMVKVL
GAYPTQAMWPLLGLSRSINNQRRTRARDIISNIQRQFVSIGQQEIANSFSEGMRLVEELISLAGHDPANQRKIHIRLSRIRSKILVPVQAALTTVLPASG
LAPRDDQHSAFSPQAQIHIKAFSDKADVMMTKEKPKRIEVLGSDGRLYPFLCKREKTGDLRKDARMMEFNTMINKLLQKDGEGRKRKLRLRTYAVVCLNE
ESGLMEWVRNTKAMRQLIGQIHKTERGFIQPVRLTHEIKERFLTMQKKYADNVPKMAAYYRRNVLSLPVFTPRFHQWFCNNFVDPTAWFESRLTFSRSAA
VWSMVGHIIGLGDRHGENILIDCTNGECVHVDFDCLFDKGLKLAKPEIVPFRLTPNMIDAFGITGYEGVFRRVCEVTMHLLRGNKETLRSVLESFIHDPL
VEWGRKGKATQSAAGAPSAARSIADISNDRSKEETRIILKTIDDRLRGIYNLGDAIRPHVSSSHRSILPENETLPLSVQGQVDKLIHEATSHENLAQMYI
GWMPFL_