Scaffold : Scaffold_1
Gene_id : Pytir_DAOMBR486fgenesh-pir_contig_1-abinit-gene-0.181
Description : Binding protein
ATGAACCGACAGACGCTGGCCGAGGCCACGAGCCTCCACGATGGCCCCGTGCCCATCTATCTCATGGAGGAGATTGCGCGTACGTGCCCCTTGCTCTGTG
TATATATATGTGCACGTGGTTATGGAGGAAAAAAAGGGGGGAGACTTGGCAGAATGAGCCATTTGAATATGAGGAGACGCTAAATGTGCGGTTTGCGCGT
TTTGTGACGTGGATTGCGCGTACACAGGATCGACCAAGGAGAGCGCGCGTGATGCGGAGAAAGTGGCGGACTTCATGCTTGGCCGCCTCAACAAGAGCAA
TCTGATCGTCAAGTTGAAGGCGCTGCAGCTCATTGCGGTAAGATTGCAATGTCTGATATCTACGCTTTGCATCGTTTTGTATAGTGAGGCATAGACGAGT
GGTCACTCACTAATGTGTTGCTGTGTGTATTGCATGATTCCAGTTCTGCGTTCGTGAGGGAAGTCCTGCGTTTGCCGGCGCCGTCCGCGAAGAAGAGCAG
GAGATCGCTGCGTACCTGCGTGAGTAGCGTGTTATTTGAAGAGAGAGAGGATTTCGTATGCGAGTGAGGCGCATCTAATGACTGTTGTATGTGTGTTGCT
GCTACTGCTGCTGTGATCACAGAGTACACGGGGCCGCCTGATCCGGTCTACGGCGATGAGCGCTACCGTCGAATCCGCGTTGCTGCGCAGGTGGGTGAAC
TTTGTTTCTATATTTTCAGCTGCGCTTTGTGTCGTTATGAATGGCGTAACGACTGAGCAATGTCACTGACTGACTCCTGGTGCCTTTTTATGATTGCAGG
AAGCGTTGGTGTGTCTGAACGACGGCAGTTTGTCCCGCCATAGCGAGCCTGCGCACAACAACATGAGCGCTCCGAGCGGCGGCAACAGCTGGCAATCGGG
TCCGCAGAATGGCGCGTCACCTGCCCCGTATCGGGATCAGCCAGCGTATGGAGGGTCTGCGCCAGCGTACGGAGGTGCGAGCAGCTACGATCAGCAGCAA
CAACAACAAGGACGATTTGGAGGGCCGAATAGCCAGTCACCAGCGCACCCAGGCTCGCAGCCGTGGGGAAACAGCAACAGCGCGTCGCGTCCAGCGCCGT
ACCAGGACACCCCGGCTTCTTCATATGGCAACCCTTCGGGAGGCTACAATGGACCAGCGGGCGGAGCTCCTCCTCAGTACGGTGGCAACGGCAGCTACGG
ACAGAGCGTAGGCGGCTATGGAGGACCTTCCGGTCCTGGCGGGTACGGACCAAACGACGGCGGCAACGGCGGAGGCTACGGCTACAACAACGGTGGTGGC
CAGAGCGCCCCGCCAGCAAGCGGTTTGGACTCGTGGTCCAGTGCTCCTGTCGGCGGCGCGCCAGTTAAGTCGACTGCGTCCGGCATGTGGAGCAGCTCTG
GATACCAGAAGAAAGATCCATCGGCGTCTGCGGATCTCCCACGTTACAACGCATCTCGCTTGGCTCGTGATAACCGTCCAACTGTACTTGTAGGTCACTC
GTTGAACTTTCCGAAGCCAGCGAGCGGGTACAATGGGCCAAGCGGCGGGTATGGGGGCAACAGTGGCGGTGGTGGCTACGGCGTTAGCGGAGCTGCCTAC
GGTGGCAACAGTGGCGGAGTCGGTGGCTACGGTGGCAACGCTAGTGGCGGCGGTGTCTACGGTGGAAATGGAGGTGGCGGCTACGGCGGGAACAGCAGCG
GCTTTGGCGGCAGCGGACCGGGAGGTTTCAACAACCAATCCAGCGGCATGCCAGGCTTCATGGACAACTCGAACAGGTTCAACAGCAATCGTTCAGGCAT
GGGGATGACAAACACACAGCCTCTCCACGTGAACCAAGCTCCGACGACGAAGTTGGGCAAAACGGTCGAAGGGTTGAAGAAGATCAGCAACGAAGCTCGC
GAGCGATGGGACCGTCGAAACATGGATAAGTCGATGGCATCTTCTTTAGCGGACCACGACGAGCTTCGCGCGGGACAGGTGATGGATCGCGGCTACCAGT
ATCAGCCGAATGCGCAGCACGGCACTGGCGGCGGAGACACTAGCAGAGACTATGAGCGCGGTCTTATCGACAACCTCTGCGCATCCGTTGGTCTGTCGCG
CGCACCGCCAGCAGATGCGCTGAAGCGATTCGTGGACTTGGCACAGACGCTCGATGTGCAAACGATCGGTGACATTCTCCTGGACAAGCTCGAAGACCCG
TCATGGCAAGTGCGTCTGAAAGGACTGCACGTCGTCGTGGCACTCTTGGAATCCCCAAATGGCGCTCCATACATGGACTGGTTTGACGAAAATGTTGACG
TGCTGGAAGAGGTACGTTTGTTGTCTGTGCACTGTGTTTCATTTTTCAAGTCACTCATCTCGTAAAATCTATTTTCTATTGTACGAAATCTTGTTTCCAG
CTTCGCAAAGACACCAAGCCCAGTGTGGTGTCCAAGACGCTCCAGGTATTGCGGATCCTGGGCTTCGCGGACGAATCCGAGCCGCAACCACCTGTGCAAA
AGCGTCCGTCTAATGCGCGGTCCGACCGCAGCTCGACGTCGTCTTCGGCAGTGCACACCCCATCGTCGCAAGCGCCAGCGGCTCACCAGCACCAAGCCCA
CGAAGAAGTGGACTTGCTCGGCTTTGGCTCGCTTAGTATCCAGCAGCAACCTCCTGCGCAAGCTATCGCACAACCAAATATCTATGGCTCGCCACCTTCT
GCGCCAGTGCAAGCTCCACCAGCACCACAGCAGGAAGTCTCGGTAAGCTTGTGTGTGAGGTAGCTATTTTCACAATGTCGCACATATGTTTAACACTCTG
TCTGTGCATTTGTAGCTCTTGGACGATTTCGACCCATTAAACAGCTCGAACGGCTCCAACTATGCAGCCCAGCAACAGTACGCCCCACTGCAACAACAGC
AGCAAATGTATGCTCAGCAGCAATATGCCCAGCAACAGCAGTACCAGCAACAAATGTACCAGCAACAACAGCAGCAGCTGCAGCAGGGACTTCCCATGCA
AGTCCAAGCTCAAGCTCCGATGCCAGCGCCGCTGGACGAGCGATCGCAGACACTGAGCCATTTTGGCAAAGACTTGTTCACGATCGCCAATTCGCCGCGC
AACTCGACGTCGTCGGCTGAGAACAACGCTCCTGCTGGTGCTCCTGGCGGTGGCGAGAAGTCGGCGTTTGGGTTCATGTA
	
	
ATGAACCGACAGACGCTGGCCGAGGCCACGAGCCTCCACGATGGCCCCGTGCCCATCTATCTCATGGAGGAGATTGCGCGATCGACCAAGGAGAGCGCGC
GTGATGCGGAGAAAGTGGCGGACTTCATGCTTGGCCGCCTCAACAAGAGCAATCTGATCGTCAAGTTGAAGGCGCTGCAGCTCATTGCGTTCTGCGTTCG
TGAGGGAAGTCCTGCGTTTGCCGGCGCCGTCCGCGAAGAAGAGCAGGAGATCGCTGCGTACCTGCAGTACACGGGGCCGCCTGATCCGGTCTACGGCGAT
GAGCGCTACCGTCGAATCCGCGTTGCTGCGCAGGAAGCGTTGGTGTGTCTGAACGACGGCAGTTTGTCCCGCCATAGCGAGCCTGCGCACAACAACATGA
GCGCTCCGAGCGGCGGCAACAGCTGGCAATCGGGTCCGCAGAATGGCGCGTCACCTGCCCCGTATCGGGATCAGCCAGCGTATGGAGGGTCTGCGCCAGC
GTACGGAGGTGCGAGCAGCTACGATCAGCAGCAACAACAACAAGGACGATTTGGAGGGCCGAATAGCCAGTCACCAGCGCACCCAGGCTCGCAGCCGTGG
GGAAACAGCAACAGCGCGTCGCGTCCAGCGCCGTACCAGGACACCCCGGCTTCTTCATATGGCAACCCTTCGGGAGGCTACAATGGACCAGCGGGCGGAG
CTCCTCCTCAGTACGGTGGCAACGGCAGCTACGGACAGAGCGTAGGCGGCTATGGAGGACCTTCCGGTCCTGGCGGGTACGGACCAAACGACGGCGGCAA
CGGCGGAGGCTACGGCTACAACAACGGTGGTGGCCAGAGCGCCCCGCCAGCAAGCGGTTTGGACTCGTGGTCCAGTGCTCCTGTCGGCGGCGCGCCAGTT
AAGTCGACTGCGTCCGGCATGTGGAGCAGCTCTGGATACCAGAAGAAAGATCCATCGGCGTCTGCGGATCTCCCACGTTACAACGCATCTCGCTTGGCTC
GTGATAACCGTCCAACTGTACTTGTAGGTCACTCGTTGAACTTTCCGAAGCCAGCGAGCGGGTACAATGGGCCAAGCGGCGGGTATGGGGGCAACAGTGG
CGGTGGTGGCTACGGCGTTAGCGGAGCTGCCTACGGTGGCAACAGTGGCGGAGTCGGTGGCTACGGTGGCAACGCTAGTGGCGGCGGTGTCTACGGTGGA
AATGGAGGTGGCGGCTACGGCGGGAACAGCAGCGGCTTTGGCGGCAGCGGACCGGGAGGTTTCAACAACCAATCCAGCGGCATGCCAGGCTTCATGGACA
ACTCGAACAGGTTCAACAGCAATCGTTCAGGCATGGGGATGACAAACACACAGCCTCTCCACGTGAACCAAGCTCCGACGACGAAGTTGGGCAAAACGGT
CGAAGGGTTGAAGAAGATCAGCAACGAAGCTCGCGAGCGATGGGACCGTCGAAACATGGATAAGTCGATGGCATCTTCTTTAGCGGACCACGACGAGCTT
CGCGCGGGACAGGTGATGGATCGCGGCTACCAGTATCAGCCGAATGCGCAGCACGGCACTGGCGGCGGAGACACTAGCAGAGACTATGAGCGCGGTCTTA
TCGACAACCTCTGCGCATCCGTTGGTCTGTCGCGCGCACCGCCAGCAGATGCGCTGAAGCGATTCGTGGACTTGGCACAGACGCTCGATGTGCAAACGAT
CGGTGACATTCTCCTGGACAAGCTCGAAGACCCGTCATGGCAAGTGCGTCTGAAAGGACTGCACGTCGTCGTGGCACTCTTGGAATCCCCAAATGGCGCT
CCATACATGGACTGGTTTGACGAAAATGTTGACGTGCTGGAAGAGCTTCGCAAAGACACCAAGCCCAGTGTGGTGTCCAAGACGCTCCAGGTATTGCGGA
TCCTGGGCTTCGCGGACGAATCCGAGCCGCAACCACCTGTGCAAAAGCGTCCGTCTAATGCGCGGTCCGACCGCAGCTCGACGTCGTCTTCGGCAGTGCA
CACCCCATCGTCGCAAGCGCCAGCGGCTCACCAGCACCAAGCCCACGAAGAAGTGGACTTGCTCGGCTTTGGCTCGCTTAGTATCCAGCAGCAACCTCCT
GCGCAAGCTATCGCACAACCAAATATCTATGGCTCGCCACCTTCTGCGCCAGTGCAAGCTCCACCAGCACCACAGCAGGAAGTCTCGCTCTTGGACGATT
TCGACCCATTAAACAGCTCGAACGGCTCCAACTATGCAGCCCAGCAACAGTACGCCCCACTGCAACAACAGCAGCAAATGTATGCTCAGCAGCAATATGC
CCAGCAACAGCAGTACCAGCAACAAATGTACCAGCAACAACAGCAGCAGCTGCAGCAGGGACTTCCCATGCAAGTCCAAGCTCAAGCTCCGATGCCAGCG
CCGCTGGACGAGCGATCGCAGACACTGAGCCATTTTGGCAAAGACTTGTTCACGATCGCCAATTCGCCGCGCAACTCGACGTCGTCGGCTGAGAACAACG
CTCCTGCTGGTGCTCCTGGCGGTGGCGAGAAGTCGGCGTTTGGGTTCATGTAG
	
	
MNRQTLAEATSLHDGPVPIYLMEEIARSTKESARDAEKVADFMLGRLNKSNLIVKLKALQLIAFCVREGSPAFAGAVREEEQEIAAYLQYTGPPDPVYGD
ERYRRIRVAAQEALVCLNDGSLSRHSEPAHNNMSAPSGGNSWQSGPQNGASPAPYRDQPAYGGSAPAYGGASSYDQQQQQQGRFGGPNSQSPAHPGSQPW
GNSNSASRPAPYQDTPASSYGNPSGGYNGPAGGAPPQYGGNGSYGQSVGGYGGPSGPGGYGPNDGGNGGGYGYNNGGGQSAPPASGLDSWSSAPVGGAPV
KSTASGMWSSSGYQKKDPSASADLPRYNASRLARDNRPTVLVGHSLNFPKPASGYNGPSGGYGGNSGGGGYGVSGAAYGGNSGGVGGYGGNASGGGVYGG
NGGGGYGGNSSGFGGSGPGGFNNQSSGMPGFMDNSNRFNSNRSGMGMTNTQPLHVNQAPTTKLGKTVEGLKKISNEARERWDRRNMDKSMASSLADHDEL
RAGQVMDRGYQYQPNAQHGTGGGDTSRDYERGLIDNLCASVGLSRAPPADALKRFVDLAQTLDVQTIGDILLDKLEDPSWQVRLKGLHVVVALLESPNGA
PYMDWFDENVDVLEELRKDTKPSVVSKTLQVLRILGFADESEPQPPVQKRPSNARSDRSSTSSSAVHTPSSQAPAAHQHQAHEEVDLLGFGSLSIQQQPP
AQAIAQPNIYGSPPSAPVQAPPAPQQEVSLLDDFDPLNSSNGSNYAAQQQYAPLQQQQQMYAQQQYAQQQQYQQQMYQQQQQQLQQGLPMQVQAQAPMPA
PLDERSQTLSHFGKDLFTIANSPRNSTSSAENNAPAGAPGGGEKSAFGFM_