Scaffold : Scaffold_1
Gene_id : Phyag_g32
Description : hypothetical protein
ATGAAGCTTCGcgtgcgcttcctgctcgGTACGTCCTCGCCCACAGCTCATAGCTCCCCCGCCGCTACAAACTAGCCACCTATTATGCAGGCAACGCGTG
CAGCTTTATAtcgttgatgctgctgctagcagcGAGCAGTGGCCACAAGTGGGCGCGCGACGCTGTCAACTCGGTGGACATCGGGCTCTGGTACCTCACG
GTGCGAAACTTTCGTCTCGAATCTCTTGATCCTTTATCTAACGACCGCGAATCCCCGCTAGTCAGGGTACAGGCGTGCGCTACAAACTCATCAACGCTGG
CGCCCCAGTCCACAGTACGTCGGCGGACCAACCTTTCGCGCTTTACAGCCGCTTCTGGTAAAGTGTTGAGAGTCTTCTGCTGTTGGTCGTGCGAACTGAC
GCTCGGGTGATCCACCAGCTCGCTCTCAATTGTTTCCTCCAGCGATCCGTGGTGTCtgggagatgctgcagccacgaggGCCTTTGTGgtcttggcgttg
ctggccgCCATTGTCAGCTTTGTTCTGAGTGCTATGGTGGCGCTTGATATCAAAATCCCCACGTGGaatggagaaggaaaagagGCCACACTAGTCACTC
CGGTGGTGTGCTCGTTGTTCGAGACAGTGATGCTGATCCCTGCGGTGACGTTGTGGCATCGCATGGTGACCGACTACGACGAGCAATGCCGGGAAGCAAG
AAAGATCGATACGTTCACATGCATTGAATTGGGCTCGACGCATAGTTGTGCTATAGCTTCGAtcccatttgctgctgtcaccTTTGTGCTGTGGCGGCTT
TCACATTCTTACCACGTGAGGTTCTTGGGTTCTTGAgtagcaccaccaccaccccTGTATGGATTGATTTGTTTTTGGTCTCATTGGTGGTGTAGGAAGC
GAAACGAGATGGCAGAATCGCCGATGGGTTTACGCTGGCGGCGAAAACAGGCAAAAATTGTCAATTTGTACCATGTTGCATGTAAGACTGAAGAGATTGA
CGGGAAGTGTGATTTCTCTTGCAGACAACGTCGACGAAATACTCTCGGGCATCGCAAACAATATAGATATCGATGCAAATGGCTCTGATGGCAGAAACGC
TTTGCACTGGGCGTGTACGCTGCACCGCACGAGCATTTGCCATGTCCTGCTGAAGAAGGGGGCTTCGATTAGTGTGAAAGATGTACGTTTTGTGAGTGGC
ATTACCTCCTACGGAAGCTAAGCTAACACGTAACATGTGGACATTGCTTTTTTCTTTTTCACAGAGGGATGGCTGGACTCCACTTCATTGGGCTAGCCGT
GTTGGCAATATGGATATCGTGCGTCTTCTGGCAAAGTGTGGTGCTAACTTGAACGTACAGGACCGATGGGGAACAACTCCTTTGATGTTGACAGTCGTCG
GTGAAAGCAAGCTCGCTGCGGAAACGCTTATCGATCTGGGAGCTTCAGTCAATGCACGAAATGTGGGTCTTCATCACGATGGATTGCACCCTCCAAGTAG
TGCTCACGTTTTCCTTGATCTATAGATATTTGGGCAGACGTCTCTAATGCTCTGTGCCGAAGGAGGAGCACCTCTGCATCAGCTAGGCATGGTGTTCTTA
AACGCTGGATCGGATATCACCTTGCAAGATGTACATACGTCGGGGTCAAACATTCATGGTAATATCCACAGATGACTAACAATTGTATGCATGACGTTGC
AGGCACAAGGGATGACAGCATTGCACTATGCGGCTGCGAATGGTAGTGTTAATTTGCTGATGAAcatgctccagcagtgcgaCGCTGAGCTGGTCGATAA
GACGAACAAGGTACCTCAAGCTTAAAATTTGTCTTCACGAGTTTCTGGCGACCAGCGCTAACGCTCTGCACGTAAACTTACGAACAGTTTGGAGAAACAC
TGTCGTATCTCGCTGTTCTTCACTCTAAACCGAAGATATTGGACCTCGTGAAAAATTGGAGAGAAGGAAACCCGATTGTTGCATctcacgacgacgacaa
tgaagaaggaggaggacacgATGACAGTACAGAATCatccgacgacgacgatagcgacgacagcagcgaagaggacgacTA
	
	
ATGAAGCTTCGcgtgcgcttcctgctcgcGAGCAGTGGCCACAAGTGGGCGCGCGACGCTGTCAACTCGGTGGACATCGGGCTCTGGTACCTCACGGGTA
CAGGCGTGCGCTACAAACTCATCAACGCTGGCGCCCCAGTCCACAGTACGTCGGCGGACCAACCTTTCGCGCTTTACAGCCGCTTCTGCGATCCGTGGTG
TCtgggagatgctgcagccacgaggGCCTTTGTGgtcttggcgttgctggccgCCATTGTCAGCTTTGTTCTGAGTGCTATGGTGGCGCTTGATATCAAA
ATCCCCACGTGGaatggagaaggaaaagagGCCACACTAGTCACTCCGGTGGTGTGCTCGTTGTTCGAGACAGTGATGCTGATCCCTGCGGTGACGTTGT
GGCATCGCATGGCACAAGGGATGACAGCATTGCACTATGCGGCTGCGAATGGTAGTGTTAATTTGCTGATGAAcatgctccagcagtgcgaCGCTGAGCT
GGTCGATAAGACGAACAAGTTTGGAGAAACACTGTCGTATCTCGCTGTTCTTCACTCTAAACCGAAGATATTGGACCTCGTGAAAAATTGGAGAGAAGGA
AACCCGATTGTTGCATctcacgacgacgacaatgaagaaggaggaggacacgATGACAGTACAGAATCatccgacgacgacgatagcgacgacagcagcg
aagaggacgacTAG
	
	
MKLRVRFLLASSGHKWARDAVNSVDIGLWYLTGTGVRYKLINAGAPVHSTSADQPFALYSRFCDPWCLGDAAATRAFVVLALLAAIVSFVLSAMVALDIK
IPTWNGEGKEATLVTPVVCSLFETVMLIPAVTLWHRMAQGMTALHYAAANGSVNLLMNMLQQCDAELVDKTNKFGETLSYLAVLHSKPKILDLVKNWREG
NPIVASHDDDNEEGGGHDDSTESSDDDDSDDSSEEDD_