Scaffold : Scaffold_1
Gene_id : Pytve_DAOMBR484fgenesh_masked-pve_contig_1-abinit-gene-0.127
Description : 40S ribosomal protein S15a
ATGGTTCGCATGAGCGTGCTGTCCGACTGTCTTAAGACGATCTACAACGCCGAGAAGCGCGGCAAGCGCCAGGTGCTGATCCGCCCTTCGTCGAAGGTGA
TCGTCAAGTTCCTGCAGGTGATGCAGAAGAACGGTGCGTTCGCGTTTGACGCTCGTGTCGGTGTCGCGAGGGAGAGATTTCTGACTCTGTACCTTGGAAC
AGGCTACATTGGCGAGTTCGAGATCGTTGACGACCACCGCGCCGGCAAGATCGTGGTGGAGCTGAAGGGCCGCATCAACAAGTGCGGTGTGATCTCGCCG
CGCTTCGACATCAAGCTGCAGGACTACGAGAAGTGGATCAACAACCTGCTGCCGTCGCGCCAGTTCGGCCACATCGTGGTGAGCACCACGTTCGGCATCA
TGGACCACCACGAGGCCCGCCGAAAGCACACGGGTGGCAAGATCATCGGCTTCTTCTACTA
	
	
ATGGTTCGCATGAGCGTGCTGTCCGACTGTCTTAAGACGATCTACAACGCCGAGAAGCGCGGCAAGCGCCAGGTGCTGATCCGCCCTTCGTCGAAGGTGA
TCGTCAAGTTCCTGCAGGTGATGCAGAAGAACGGCTACATTGGCGAGTTCGAGATCGTTGACGACCACCGCGCCGGCAAGATCGTGGTGGAGCTGAAGGG
CCGCATCAACAAGTGCGGTGTGATCTCGCCGCGCTTCGACATCAAGCTGCAGGACTACGAGAAGTGGATCAACAACCTGCTGCCGTCGCGCCAGTTCGGC
CACATCGTGGTGAGCACCACGTTCGGCATCATGGACCACCACGAGGCCCGCCGAAAGCACACGGGTGGCAAGATCATCGGCTTCTTCTACTAA
	
	
MVRMSVLSDCLKTIYNAEKRGKRQVLIRPSSKVIVKFLQVMQKNGYIGEFEIVDDHRAGKIVVELKGRINKCGVISPRFDIKLQDYEKWINNLLPSRQFG
HIVVSTTFGIMDHHEARRKHTGGKIIGFFY_