Scaffold : Scaffold_1
Gene_id : Phyra_38878
Description : DNA repair and recombination protein RAD54
GTTGTGGATGCACCGCCGCCTCTTGTGCTGTGGCAAAGTGAGACGGACCCAGAGATGAAAGTGGTGGTGCCCGAGATCGTGGGCAAGTTCCTGCGTCCTC
ATCAGCGTGAAGGTGTGCAGTTCATGTTCGACTGTGTATGCCAAGTACGAGGCTTCGACGGACAAGGTTGCATCTTGGCTGATGATATGGGCCTGGGAAA
GACCTTGCAGAGCATCGCGCTGATGTACACGCTGCAGATGACGGGGATGAACATGCAGCCGACGGTAAAGCGAACAATTGTGGTATGTCCTACGTCGTTG
GTGAAGAACTGGGACGATGAAATTATCAAGTGGCTGCACGGTCGTGTGAAGACGGTGGCGCTGTTTGAGGCCAAGCGCGAGACGGTGATCAAAGGCATCA
ACCAGTTTATCGAGGGAAGCAAGAGGCCTAGACCAGGGTTTTCTGCTCAGGTGCTTATCATCTCGTACGAAACGTTCCGCATGCACGTGCAGAAATTTGC
AGATACACCCGCTTGCTGCGATTTGCTAATTTGTGACGAAGCCCATCGACTGAAGAACGCCAACTCGCAGATCAACAAGGCGCTATCGTCGCTGGCGTGC
AGAAAGCGAGTGCTTCTATCTGGTACACCGATGCAAAACGATCTGGATGAGTTTTTCGCTATGGTGGATTTCACCAACCCGAATATCCTCGGCACGCCAA
GTGAGTTCCGAAAGAATTATCTTGGCCCGATCTTGATTGGTCGAGAACCGGACTCGACGGATCGTGAACGTGGCGTGGCGCAGTCGTGCTCAGCAATGCT
TTGCGAAATTGTGAATCAGTTCATTTTGCGCAGAGGTAACATCTTAAACGCCAAGCATTTGCCACCAAAGTTGATGCAGGTAGTTTGCTGTCCGCTGTCT
CCACTGCAGGAGCAGCTCTACATGCATTTTCTGTCGTCCAATGCCTGTCGGGATATGATGAAGCGCAAGAGCGTGAACGTTTTATCGTCAATTACGGCAC
TGAAGAAGCTGTGCAACCACCCACTACTGATTTTCGACGAAATGGGTAAAACCAACACGAAATTGCCTGGTTTTGGCGACTGCGCACAATATTTTGTGGC
AGCTAAGGAGTCCCGAGAGAGTGGTGGTGATGATGGTCGGCATCGACGAGGGGGCTTTGGTGGACGCACATGCTACCCAGAGTGGTCGGGTAAGATGCTT
TTGCTGGACCGTTTGATGCTTTCGATGAGGAAAACAACAACGGACCGAATTGTGATCGTGTCCAACTACACACAAACGTTGGATGTCGTGTCTAGCCTAT
GTCAAGAACGGCATTTGCCCTTTGTTCGCCTGGACGGAACGACATCTGCCAAGAAACGAAAGAAACTGGTCGACACTTTCAATGATCCAACGACAAATTC
GTTTGCTTTCTTGCTTTCGAGCAAAGCTGGCGGGTGTGGTTTGAACTTGATTGGTGCAAACCGCTTGGTACTATTTGACCCTGATTGGAATCCTGCGACA
GACAAGCAAGCTGCTGCTCGAGTGTGGCGTGAAGGTCAAAAGAAGATGTGCTACGTGTACCGTTTCCTGGCGACGGGGACACTCGAAGAGAAAATCTTTC
AGCGCCAGCTGTCCAAGGAGGGTCTTCAAAATATCGTTGATGATAAAGAAGAGGTGAATTCACTGTCCTCAAAGGATTTAAAGCGGCTATTCGTGTTTCG
GAAAGA
	
	
GTTGTGGATGCACCGCCGCCTCTTGTGCTGTGGCAAAGTGAGACGGACCCAGAGATGAAAGTGGTGGTGCCCGAGATCGTGGGCAAGTTCCTGCGTCCTC
ATCAGCGTGAAGGTGTGCAGTTCATGTTCGACTGTGTATGCCAAGTACGAGGCTTCGACGGACAAGGTTGCATCTTGGCTGATGATATGGGCCTGGGAAA
GACCTTGCAGAGCATCGCGCTGATGTACACGCTGCAGATGACGGGGATGAACATGCAGCCGACGGTAAAGCGAACAATTGTGGTATGTCCTACGTCGTTG
GTGAAGAACTGGGACGATGAAATTATCAAGTGGCTGCACGGTCGTGTGAAGACGGTGGCGCTGTTTGAGGCCAAGCGCGAGACGGTGATCAAAGGCATCA
ACCAGTTTATCGAGGGAAGCAAGAGGCCTAGACCAGGGTTTTCTGCTCAGGTGCTTATCATCTCGTACGAAACGTTCCGCATGCACGTGCAGAAATTTGC
AGATACACCCGCTTGCTGCGATTTGCTAATTTGTGACGAAGCCCATCGACTGAAGAACGCCAACTCGCAGATCAACAAGGCGCTATCGTCGCTGGCGTGC
AGAAAGCGAGTGCTTCTATCTGGTACACCGATGCAAAACGATCTGGATGAGTTTTTCGCTATGGTGGATTTCACCAACCCGAATATCCTCGGCACGCCAA
GTGAGTTCCGAAAGAATTATCTTGGCCCGATCTTGATTGGTCGAGAACCGGACTCGACGGATCGTGAACGTGGCGTGGCGCAGTCGTGCTCAGCAATGCT
TTGCGAAATTGTGAATCAGTTCATTTTGCGCAGAGGTAACATCTTAAACGCCAAGCATTTGCCACCAAAGTTGATGCAGGTAGTTTGCTGTCCGCTGTCT
CCACTGCAGGAGCAGCTCTACATGCATTTTCTGTCGTCCAATGCCTGTCGGGATATGATGAAGCGCAAGAGCGTGAACGTTTTATCGTCAATTACGGCAC
TGAAGAAGCTGTGCAACCACCCACTACTGATTTTCGACGAAATGGGTAAAACCAACACGAAATTGCCTGGTTTTGGCGACTGCGCACAATATTTTGTGGC
AGCTAAGGAGTCCCGAGAGAGTGGTGGTGATGATGGTCGGCATCGACGAGGGGGCTTTGGTGGACGCACATGCTACCCAGAGTGGTCGGGTAAGATGCTT
TTGCTGGACCGTTTGATGCTTTCGATGAGGAAAACAACAACGGACCGAATTGTGATCGTGTCCAACTACACACAAACGTTGGATGTCGTGTCTAGCCTAT
GTCAAGAACGGCATTTGCCCTTTGTTCGCCTGGACGGAACGACATCTGCCAAGAAACGAAAGAAACTGGTCGACACTTTCAATGATCCAACGACAAATTC
GTTTGCTTTCTTGCTTTCGAGCAAAGCTGGCGGGTGTGGTTTGAACTTGATTGGTGCAAACCGCTTGGTACTATTTGACCCTGATTGGAATCCTGCGACA
GACAAGCAAGCTGCTGCTCGAGTGTGGCGTGAAGGTCAAAAGAAGATGTGCTACGTGTACCGTTTCCTGGCGACGGGGACACTCGAAGAGAAAATCTTTC
AGCGCCAGCTGTCCAAGGAGGGTCTTCAAAATATCGTTGATGATAAAGAAGAGGTGAATTCACTGTCCTCAAAGGATTTAAAGCGGCTATTCGTGTTTCG
GAAAGAC
	
	
VVDAPPPLVLWQSETDPEMKVVVPEIVGKFLRPHQREGVQFMFDCVCQVRGFDGQGCILADDMGLGKTLQSIALMYTLQMTGMNMQPTVKRTIVVCPTSL
VKNWDDEIIKWLHGRVKTVALFEAKRETVIKGINQFIEGSKRPRPGFSAQVLIISYETFRMHVQKFADTPACCDLLICDEAHRLKNANSQINKALSSLAC
RKRVLLSGTPMQNDLDEFFAMVDFTNPNILGTPSEFRKNYLGPILIGREPDSTDRERGVAQSCSAMLCEIVNQFILRRGNILNAKHLPPKLMQVVCCPLS
PLQEQLYMHFLSSNACRDMMKRKSVNVLSSITALKKLCNHPLLIFDEMGKTNTKLPGFGDCAQYFVAAKESRESGGDDGRHRRGGFGGRTCYPEWSGKML
LLDRLMLSMRKTTTDRIVIVSNYTQTLDVVSSLCQERHLPFVRLDGTTSAKKRKKLVDTFNDPTTNSFAFLLSSKAGGCGLNLIGANRLVLFDPDWNPAT
DKQAAARVWREGQKKMCYVYRFLATGTLEEKIFQRQLSKEGLQNIVDDKEEVNSLSSKDLKRLFVFRKD